(data stored in ACNUC7421 zone)

EMBL: CP001854.PE9

CP001854.PE9         Location/Qualifiers
FT   CDS_pept        complement(11243..11779)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cwoe_0009"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cwoe_0009"
FT                   /db_xref="EnsemblGenomes-Tr:ADB48445"
FT                   /db_xref="GOA:D3EYR2"
FT                   /db_xref="InterPro:IPR027981"
FT                   /db_xref="UniProtKB/TrEMBL:D3EYR2"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADB48445.1"
FT                   /translation="MDELTSTTGIVAIAGCAVAVIALGVASSVAVALRRVRRDQRAVLG
FT                   EGMRATDLVSHAAGLEREYRALHAFVEEAAGRLHERMGAAEARLDGAIAYHALVRYDAY
FT                   GEMSGHQSTSIALLDAQRNGVVLSSIMHRDAARLYAKQVHRGRGELELSPEEAEAVRLA
FT                   LEPDDADLDAGPRGR"
     gtggacgagc tgaccagcac gacaggcatc gtggcgatcg ccggctgtgc cgtcgcggtc        60
     atcgcgctcg gcgtcgccag ctcggtcgcg gtcgcgctgc ggcgcgtccg gcgcgaccag       120
     cgcgcggtcc tcggcgaggg gatgcgcgca accgacctcg tctcccacgc ggcgggtctg       180
     gagcgcgagt accgcgcgct gcacgcgttc gtcgaggagg cggccgggcg cctgcacgag       240
     cggatgggcg cggccgaggc gcggctggac ggcgcgatcg cctaccacgc gctcgtgcgc       300
     tacgacgcct acggcgagat gtccggccac cagtcgacgt cgatcgcgct gctcgacgcg       360
     cagcgcaacg gcgtcgtgct gtcgtcgatc atgcaccgcg acgccgcgcg gctctacgcc       420
     aagcaggtgc accgcggtcg cggcgagctg gagctgtcgc cggaggaggc cgaggcggtg       480
     cggctcgcgc tcgagcccga cgacgccgac ctcgacgccg gtccgcgcgg gcgctag          537
//

If you have problems or comments...

PBIL Back to PBIL home page