(data stored in ACNUC7421 zone)

EMBL: CP001854.PE90

CP001854.PE90        Location/Qualifiers
FT   CDS_pept        complement(86584..87132)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cwoe_0090"
FT                   /product="protein of unknown function DUF179"
FT                   /note="PFAM: protein of unknown function DUF179; KEGG:
FT                   hha:Hhal_0938 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cwoe_0090"
FT                   /db_xref="EnsemblGenomes-Tr:ADB48526"
FT                   /db_xref="InterPro:IPR003774"
FT                   /db_xref="UniProtKB/TrEMBL:D3F443"
FT                   /inference="protein motif:PFAM:PF02622"
FT                   /protein_id="ADB48526.1"
FT                   /translation="MDDSLKGKLLLASPALQDPNFARTVVLIAEHNEDGAMGLVLNRPA
FT                   TTTVAESAPELEELVEAEEPIYIGGPVQPSAVIVLAAFEEPAAAGLLVRDDVGFLSAEA
FT                   DFATSRDATRQLRVFAGHAGWGPGQLDEELEREDWIVEPPLPQELFSEDAEELWGDVLT
FT                   RKGGAFALVARMPLDPSVN"
     gtggacgatt cgctgaaggg caagctgctg ctggcgtccc cggcgctgca ggacccgaac        60
     ttcgcgcgca ccgtcgtgct gatcgccgag cacaacgagg acggggcgat ggggctcgtg       120
     ctgaaccggc cggcgacgac gaccgtcgcc gagagcgcgc cggagctgga ggagctggtc       180
     gaggcggagg agccgatcta catcggcggg ccggtgcagc cgtccgccgt gatcgtgctg       240
     gcggcattcg aggagccggc cgccgcgggc ctgctggtgc gcgacgacgt cggcttcctc       300
     tcggccgagg cggacttcgc cacctcacgc gacgcgacga ggcagctgcg tgtcttcgcc       360
     ggccacgctg gctggggtcc cggccagctc gacgaggagc tggagcgcga ggactggatc       420
     gtcgagccgc cgctgccgca ggagctcttc agcgaggacg ccgaagagct gtggggcgac       480
     gtgctgacgc gcaagggcgg cgccttcgcg ctggtcgcgc ggatgccgct cgacccgtcg       540
     gtcaactag                                                               549
//

If you have problems or comments...

PBIL Back to PBIL home page