(data stored in ACNUC7421 zone)

EMBL: CP001854.PE91

CP001854.PE91        Location/Qualifiers
FT   CDS_pept        complement(87182..88615)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cwoe_0091"
FT                   /product="Carotenoid oxygenase"
FT                   /note="PFAM: Carotenoid oxygenase; KEGG: cbd:CBUD_1036
FT                   lignostilbene-alpha,beta- dioxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:Cwoe_0091"
FT                   /db_xref="EnsemblGenomes-Tr:ADB48527"
FT                   /db_xref="GOA:D3F444"
FT                   /db_xref="InterPro:IPR004294"
FT                   /db_xref="UniProtKB/TrEMBL:D3F444"
FT                   /inference="protein motif:PFAM:PF03055"
FT                   /protein_id="ADB48527.1"
FT                   /translation="MATDTTETGYAQGFTTLDREVTLDRLQLDGALPEWLEGSLLRTGP
FT                   AQFEIGGRSLNHWFDGLAMLHRFTFGSGEVAYANRFLQSRARRSAEAEGRQVYGEFATD
FT                   PCRSIFGRVQSLFQPKITDNCNVNVARLGDRFVAMTETPMPVEFDPVTLATLGIAYKPP
FT                   GHVTTAHPHGDAATGEAINYVTRFGPKPTYRVYGLAAVDAPPRTIAEVAAKPVAYMHSF
FT                   GLSERYVALVEFPLVVKPLRLVLGTGPFMESFEWEPQRGTTFTVIDRRDGSLRGRYRAP
FT                   PFFAFHHVNAFDDGEQRLVLDLCAYDDAAIVRSLFLDRLRSGTAGAVPDAYLTRCTVDL
FT                   AGGGVTLERRSETPLELPRIDYGAVNGRPYRWVYGAARRAGAPAHGFIDQLVKIDAGDG
FT                   AATTWSEEGCFPGEPVFVGAPGRSSEDDGVCLSVVLDGAAGTSFLLVLDAATFTERARA
FT                   AVPHHIPFSFHGQFARGVA"
     atggcgaccg atacgacgga aaccggctac gcgcagggct tcacgacgct cgaccgcgag        60
     gtgacgctcg accggctgca gctggacggc gcgctgccgg agtggctgga ggggtcgctg       120
     ctgcggaccg gtccggcgca gttcgagatc ggcggccgct cgttgaacca ctggttcgac       180
     gggctcgcga tgctccaccg cttcacgttc ggatccggcg aggtcgcgta cgcgaaccgc       240
     ttcctgcagt cgcgcgcgcg acgcagcgcc gaggcggagg gcagacaggt ctacggcgag       300
     ttcgcgactg acccgtgtcg ctcgatcttc ggccgcgtgc agtcgctgtt ccagccgaag       360
     atcaccgaca actgcaacgt caacgtcgcg cggctcggcg accgcttcgt cgcgatgacc       420
     gagacgccga tgccggtcga gttcgacccc gtaacgctcg ccacgctcgg gatcgcgtac       480
     aagccgccgg gccacgtcac gaccgcccac ccacacggcg acgccgcgac cggcgaggcg       540
     atcaactacg tgacgcgctt cggcccgaag ccgacgtacc gcgtctacgg gctcgcggcg       600
     gtcgacgccc cgccgcggac gatcgcggag gtcgcggcga agccggtcgc ctacatgcac       660
     agcttcgggc tgagcgagcg ctacgtcgcg ctcgtcgagt tcccgctcgt cgtcaagccg       720
     ctgcggctcg tgctcggcac tgggccgttc atggagagct tcgagtggga gccgcagcgc       780
     ggcacgacgt tcaccgtgat cgaccgccgc gacggcagcc tccgcgggcg ctacagagcg       840
     ccgccgttct tcgccttcca ccacgtcaac gcgttcgacg acggcgagca gcggctcgtg       900
     ctcgacctgt gcgcctacga cgacgcggcg atcgtcagat cgctgttcct cgaccgcctg       960
     cgctcgggca cggccggcgc cgtaccggac gcctacctga cgcgctgcac cgtcgacctc      1020
     gccggcggcg gcgtgacgct ggagcggcgt tcggagacgc cgctggagct gccgcggatc      1080
     gactacgggg ccgtcaacgg acggccgtac cgctgggtct acggcgctgc ccgcagagcc      1140
     ggcgcgcccg cgcacggctt catcgaccag ctcgtgaaga tcgacgccgg cgacggcgcc      1200
     gcgacgacct ggagcgagga gggctgcttc cccggcgagc cggtcttcgt cggcgcgccc      1260
     ggccgcagct ccgaggacga cggcgtctgc ctctcggtcg tgctcgacgg cgccgccggc      1320
     acgagcttcc tgctcgtgct cgacgccgcg acgttcacgg agcgggcacg cgctgccgtc      1380
     ccccaccaca tcccgttcag cttccacggg cagttcgcgc ggggcgtggc ctag            1434
//

If you have problems or comments...

PBIL Back to PBIL home page