(data stored in ACNUC7421 zone)

EMBL: CP001854.PE92

CP001854.PE92        Location/Qualifiers
FT   CDS_pept        complement(88625..89089)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cwoe_0092"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cwoe_0092"
FT                   /db_xref="EnsemblGenomes-Tr:ADB48528"
FT                   /db_xref="UniProtKB/TrEMBL:D3F445"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADB48528.1"
FT                   /translation="MAAPSDAPLALLLLPVPLERFTHAEHARDLLRAPRVLALEPPPLS
FT                   WSRIGRLPGSLAFGIGVRQAKRVRLPGPVRVVIVYEALQLPLAQGLQLRFEGAQLWRAE
FT                   VVAEATAQASLAFDPDDAAGLGDAAGVDAFDRNAPLWERLELLGVAEFKE"
     atggccgccc cctccgacgc cccgctcgcg ctgttgctgc tgcccgtccc gctggagcgg        60
     ttcacccacg ccgagcacgc ccgcgacctg ctgcgcgcgc cgcgcgtgct ggcgctcgaa       120
     ccgccgccgc tgtcgtggag ccggatcggg cggctgccgg gctcgctcgc gttcgggatc       180
     ggcgtgcggc aggccaagcg cgtgaggctg ccgggcccgg tccgcgtcgt gatcgtctac       240
     gaggcgctgc agctgccgct cgcgcaggga ctccagctgc gcttcgaggg cgcgcagctg       300
     tggcgggcgg aggtggtcgc cgaggcgacg gcgcaggcgt cgctggcgtt cgaccccgac       360
     gacgccgccg gcctcggcga tgcggccggc gtggacgcct tcgatcgcaa cgcgccgctg       420
     tgggagcggc ttgaactgct gggtgtggcg gagttcaagg agtag                       465
//

If you have problems or comments...

PBIL Back to PBIL home page