(data stored in ACNUC7421 zone)

EMBL: CP001854.PE94

CP001854.PE94        Location/Qualifiers
FT   CDS_pept        complement(90614..91552)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cwoe_0094"
FT                   /product="glycosyl transferase family 2"
FT                   /note="PFAM: glycosyl transferase family 2; KEGG:
FT                   bbt:BBta_1007 glycosyl transferase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cwoe_0094"
FT                   /db_xref="EnsemblGenomes-Tr:ADB48530"
FT                   /db_xref="GOA:D3F4V2"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:D3F4V2"
FT                   /inference="protein motif:PFAM:PF00535"
FT                   /protein_id="ADB48530.1"
FT                   /translation="MSIEVSYCIVNTEQRALLERCLDAIAAEQRMLPFATEVLVLDNAS
FT                   RDGSVGMARAHPVTTELIRREQRRGKAENDSTLMQRARGRYCLLLNEDSELMPGATRAL
FT                   HDALDTTEKAATAGAKLLRPDGSQYPSAWRFPTPATAFWAAVGMHKSMTVQSRGDEVRE
FT                   VDWAQSAALLVRREAAARIGWMDPAFFVYSDEVDFCKRLHDAGWKNLYVPRAEAIHHEQ
FT                   LSTGNVPKRRIVELSRNRERYMRKHHSVVSTLLVRWLTAWTYALRALAAYVLPHHDPAR
FT                   YWQHVRATLHPDRGEGLREAAADYNRGGPRL"
     atgagcatcg aggtctccta ctgcatcgtc aacaccgagc agcgcgcgct gctcgagcgc        60
     tgcctcgacg cgatcgcagc cgagcagcgc atgctgccgt tcgcgaccga ggtgctcgtg       120
     ctcgacaacg cctcgcgcga cggctcggtc gggatggcgc gtgcgcatcc cgtgacgacg       180
     gagctgatca gacgcgagca gcggcgcggt aaggcggaga acgacagcac gctgatgcag       240
     cgcgcccgcg gccgctactg cctgctgctg aacgaggact ccgagctgat gccgggcgcc       300
     acgagagcgc tccacgacgc gctcgacacg accgagaagg ccgcgaccgc gggcgcgaag       360
     ctgctgcgcc ccgacggcag ccagtacccg tcggcgtggc gcttcccgac gccggcgacc       420
     gccttctggg ccgccgtcgg gatgcacaag tcgatgacgg tgcagagccg cggcgacgag       480
     gtccgcgagg tcgactgggc gcagtccgcc gcgctgctcg tgcggcgtga ggcggcggcg       540
     cggatcggct ggatggaccc ggcgttcttc gtctactccg acgaggtcga cttctgcaag       600
     cgcctgcacg acgccggctg gaagaacctc tacgtgccgc gggcggaggc gatccaccac       660
     gagcagctgt cgaccggcaa cgtgccgaag cggcggatcg tggagctgtc gcgcaaccgc       720
     gagcgctaca tgcgcaagca ccactcggtc gtctcgacgc tgcttgtgcg ctggctgacg       780
     gcgtggacgt acgcgctgcg cgcgctcgcc gcgtacgtgc tcccgcacca cgatcccgcg       840
     cgctactggc agcacgtgcg ggcgacgctg caccccgacc gcggtgaggg cctgcgcgag       900
     gcggcggcgg actacaaccg cggcggcccg cggctctag                              939
//

If you have problems or comments...

PBIL Back to PBIL home page