(data stored in ACNUC7421 zone)

EMBL: CP001854.PE95

CP001854.PE95        Location/Qualifiers
FT   CDS_pept        91576..92712
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cwoe_0095"
FT                   /product="glycosyl transferase group 1"
FT                   /note="PFAM: glycosyl transferase group 1; KEGG:
FT                   mpt:Mpe_A0723 glycosyltransferase-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cwoe_0095"
FT                   /db_xref="EnsemblGenomes-Tr:ADB48531"
FT                   /db_xref="GOA:D3F4V3"
FT                   /db_xref="InterPro:IPR028098"
FT                   /db_xref="UniProtKB/TrEMBL:D3F4V3"
FT                   /inference="protein motif:PFAM:PF00534"
FT                   /protein_id="ADB48531.1"
FT                   /translation="MSSSSLRIALVDPSAFTPPYDHALCAALARAGADVELVTSRFAYG
FT                   AVPRGQGYAVTESFYRIAPGAAGSRLRMAAKLAQHVPDMLRLRRHLRASRADVAHFQWL
FT                   TVQPLDVHLLPRRLPVVLTAHDVLPREPRPGQLDAQRRLYERVDAIVVHSEHGAARLRG
FT                   ELRVDPAKVHVIPHGALDQFVPAGGPSAAPPRPLPPELAAVGREKPVVLCFGLLRPYKG
FT                   VDVLLEAWRGIDDAELWVVGLPKMDVAPLHALAPPNVRFVSRFVADDEIAAFFDRADLV
FT                   VLPYREIDQSGVLFTALAFGKPLLLSSVGGFPEVAATGAAALVPPGDAPALHTALRDLL
FT                   ADPAARTRLGAAARAAADGPYSWDGIAQQTLALYESLQ"
     atgtcctcgt cgtcgctgcg gattgccctc gtcgacccgt cggctttcac gccgccgtac        60
     gaccatgcgc tctgtgccgc cctcgcgcgt gccggcgctg acgtggagct ggtgacgagc       120
     cgcttcgcct atggggcggt gccacgcggc caggggtacg ccgtcacgga gtcgttctat       180
     cggatcgcgc ccggcgccgc cggctcgcgg ctgcggatgg cggccaagtt ggcgcaacac       240
     gtgccggaca tgctgcgcct cagacggcac ctgcgggcct cgcgcgcgga cgtcgcgcac       300
     ttccagtggc tgacggtcca accgctcgac gtccacctgc tgccgcgcag gctgccggtc       360
     gtcctgaccg cccacgacgt gcttccgcgc gagccgcgcc cgggccagct cgacgcgcag       420
     cggcggctgt acgagcgggt cgacgcgatc gtcgtccact ccgagcatgg ggccgcgcgg       480
     ctgcgcgggg agctgcgcgt cgacccggcg aaggtgcacg tgatcccgca cggcgcgctc       540
     gaccagttcg tgccggccgg cggtccgtcg gccgcgccgc cgcgcccgct cccgcccgag       600
     ctggcggcgg tcgggcgcga gaagcccgtc gtgctctgct tcggactgct gcgcccgtac       660
     aagggcgtcg acgtgctgct ggaggcgtgg cgcgggatcg acgacgccga gctgtgggtc       720
     gtcggccttc cgaagatgga cgtcgcgccg ctgcacgcgc tcgcgccgcc gaacgtccgc       780
     ttcgtctcgc gcttcgtcgc cgacgatgag atcgccgcct tcttcgaccg cgccgacctc       840
     gtcgtgctgc cctaccgcga gatcgaccag tcgggcgtgc tgttcaccgc gctcgcgttc       900
     ggcaagccgc tgctgctcag ctccgtcggc ggcttccccg aggtcgccgc caccggcgcc       960
     gccgcgctcg tcccgcccgg cgacgccccc gccctccaca ccgccctgcg cgacctgctc      1020
     gccgaccccg ccgcccgtac ccgcctcggc gccgctgcgc gtgctgcggc agatggcccc      1080
     tactcgtggg acggcatcgc gcagcagacg ctggcgcttt acgagtcgct gcagtag         1137
//

If you have problems or comments...

PBIL Back to PBIL home page