(data stored in ACNUC7421 zone)

EMBL: CP001854.PE96

CP001854.PE96        Location/Qualifiers
FT   CDS_pept        92759..93907
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cwoe_0096"
FT                   /product="glycosyl transferase family 2"
FT                   /note="PFAM: glycosyl transferase family 2; KEGG:
FT                   afw:Anae109_2016 glycosyl transferase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cwoe_0096"
FT                   /db_xref="EnsemblGenomes-Tr:ADB48532"
FT                   /db_xref="GOA:D3F4V4"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:D3F4V4"
FT                   /inference="protein motif:PFAM:PF00535"
FT                   /protein_id="ADB48532.1"
FT                   /translation="MPVVKLLFWVCAALVVYAQAGYGLLLALLARVLPARAARTGAPVD
FT                   GGDEALPAVSVIVAAYQEESVIADKVANLKALDYPADRLQVVVACDGSPDATPQRARDA
FT                   GADLVLELPRGGKIRAQDAGVRAASGRIVAFSDANAFWEPDALRRLVAPFAGAPEVGYV
FT                   CGQVSFVNDGGTNQEGLYWRYEMALRGLESRLASVTGGNGAIYATRRESYIEVDPIMGH
FT                   DLSFPFNMVKRGWRALYAADARATEKMVPSIEGEFARKRRMMTHGWPIVLRGGMLKPDG
FT                   YGPLYGLMVFSHRLLRYATPFLHLAVLSTSLVLARRGRPYAAALALQALILLAAALAKA
FT                   IPARPFLVARYYVLTTGALAAGLYDVLREPTEAGWEPPEGTR"
     gtgcccgtcg tgaagctcct cttctgggtc tgcgccgcgc tcgtcgtcta cgcgcaggcc        60
     ggctacggtc tgctgctcgc gctgctggcg cgggtgctgc cggcgcgcgc ggcccgcacc       120
     ggcgcgccgg tcgacggcgg cgacgaggcg ctgccggcgg tctcggtgat cgtcgcggcc       180
     taccaggagg agtcggtgat cgccgacaag gtcgcgaacc tgaaggcgct cgactacccc       240
     gccgatcggc tccaggtcgt cgtcgcctgc gacggctcgc cggacgcgac gccgcagcgg       300
     gcccgtgacg ccggcgccga cctcgtgctg gagctgccac gcggcggcaa gatccgtgcg       360
     caggacgcag gcgtgcgcgc cgcgagcgga cggatcgtcg cgttctcgga cgcgaacgcc       420
     ttctgggagc cggatgcgct gcggcggctc gtcgcgccgt tcgcgggcgc gccggaggtc       480
     ggttacgtct gcgggcaggt cagcttcgtc aacgacggcg ggacgaacca ggaagggctc       540
     tactggcgct acgagatggc gctgcgcggg ctcgagtcgc ggctcgcctc ggtcacgggc       600
     ggcaacggag cgatctatgc cacgcggcgc gagtcctaca tcgaggtcga cccgatcatg       660
     ggccacgacc tctcgttccc gttcaacatg gtcaagcgcg gctggcgtgc gctctacgcc       720
     gccgacgccc gcgcgacgga gaagatggtc cccagcatcg agggcgagtt cgcccgcaag       780
     cggcggatga tgacccacgg ctggccgatc gtcctgcgcg gcgggatgct gaagcccgac       840
     ggctacggcc cgctctacgg cctgatggtc ttctcccacc gcctgctgcg ctacgcgacg       900
     ccgttcctgc acctggccgt gctctcgacc agcctcgtgc tcgcccgccg cggccgcccc       960
     tacgcggccg cgctcgcgct ccaggcgctg atcctgctcg ccgccgcgct ggcgaaggcg      1020
     atccccgcgc gcccgttcct cgtcgcgcgc tactacgtcc tcacgaccgg cgcgctcgcc      1080
     gccggcctct acgacgtcct gcgcgagccg accgaggccg gttgggaacc gccggagggc      1140
     acgcggtga                                                              1149
//

If you have problems or comments...

PBIL Back to PBIL home page