(data stored in ACNUC7421 zone)

EMBL: CP001854.PE97

CP001854.PE97        Location/Qualifiers
FT   CDS_pept        93904..94530
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cwoe_0097"
FT                   /product="Undecaprenyl-phosphate galactose
FT                   phosphotransferase"
FT                   /EC_number="2.7.8.6"
FT                   /note="PFAM: sugar transferase; KEGG: afw:Anae109_2622
FT                   undecaprenyl-phosphate galactose phosphotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Cwoe_0097"
FT                   /db_xref="EnsemblGenomes-Tr:ADB48533"
FT                   /db_xref="GOA:D3F4V5"
FT                   /db_xref="InterPro:IPR003362"
FT                   /db_xref="UniProtKB/TrEMBL:D3F4V5"
FT                   /inference="protein motif:PRIAM:2.7.8.6"
FT                   /protein_id="ADB48533.1"
FT                   /translation="MSGRAATPGAADRAARRALDLLLGGIGTIAGAPLVALAAALIRLE
FT                   SPGHPIYKQRRVGRDGRAFEIYKLRTMVRGAEFTGAGLAIQEGDDRITRMGKLLRRTSL
FT                   DELPNLWNVVRGEMSIVGPRPTVQVQVDQYTERQLGRLQVKPGITGWAQINGRASLPWS
FT                   ERIELDLWYVEHQSLKLDLRILSRTWRLVVKGDGLYKGETGGWRT"
     gtgagcggtc gcgccgccac gcccggcgcc gccgatcgcg ccgcacgacg cgcgctcgac        60
     ctgctgctcg gcgggatcgg gacgatcgcc ggcgcgccgc tcgtcgcgct cgccgcggcg       120
     ctgatccggc tcgagtcgcc cggccacccg atctacaaac agcgccgcgt cggcagggac       180
     ggcagagcgt tcgagatcta caagctgcgg acgatggtca gaggcgcgga gttcaccggc       240
     gcggggctcg cgatccagga gggcgacgac cgcatcacgc ggatgggcaa gctgctgcgc       300
     cgcacgtcgc tcgacgagct gccgaacttg tggaacgtcg tccgcggcga gatgtcgatc       360
     gtcggcccgc gtccgaccgt gcaggtgcag gtcgaccagt acaccgagcg ccagctcggc       420
     cgcctgcagg tcaagccggg catcaccggc tgggcgcaga tcaacggccg cgcgtcgctg       480
     ccgtggagcg agcggatcga gctggacctc tggtacgtcg agcaccagtc gctcaagctc       540
     gacctgagga tcctctcgcg cacctggcga ctcgtcgtca agggcgacgg cctctacaag       600
     ggagagacgg gcggatggcg gacatga                                           627
//

If you have problems or comments...

PBIL Back to PBIL home page