(data stored in ACNUC7421 zone)

EMBL: CP001854.PE98

CP001854.PE98        Location/Qualifiers
FT   CDS_pept        94518..95522
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cwoe_0098"
FT                   /product="protein of unknown function DUF201"
FT                   /note="PFAM: protein of unknown function DUF201; KEGG:
FT                   msu:MS1491 carbamoyl phosphate synthase-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cwoe_0098"
FT                   /db_xref="EnsemblGenomes-Tr:ADB48534"
FT                   /db_xref="GOA:D3F4V6"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="UniProtKB/TrEMBL:D3F4V6"
FT                   /inference="protein motif:PFAM:PF02655"
FT                   /protein_id="ADB48534.1"
FT                   /translation="MADMNGRAVLLTGVGKRYDIVSCFAAHTTVIAADPSPLAPAQYAA
FT                   THRFAPPRIDDSGYVPALAEVCARYDVGAVIPLTDLDIEVLAQARADGILPAFVPDPEI
FT                   ARATYDKYEAHLLLESHGLPSPPTVLPGEQPESYPVMVKPRQGSGARSIHLAHDAEEAA
FT                   FFVRYVKEPTMVQRAMDGPEFSIDLLSDLDGRCLNAIPRTMLESRGGESIKGTVIADRE
FT                   LIDLGVNVVETLGVRGPCTVQAFRDREIGLGITDVNTRFGGAFPGPTYATLAAGRTYPE
FT                   LIARMANGERIAPHVGEFDAGRTFTRYYWQLELDAEMQPTGRELVPGGAPPPR"
     atggcggaca tgaacggcag agcggtactg ctgaccggcg tcggcaagcg ctacgacatc        60
     gtctcctgct tcgcggcgca cacgaccgtg atcgccgccg acccgagtcc gctcgcaccg       120
     gcccagtacg ccgcgacgca ccggttcgcg ccgccgcgga tcgacgactc cggctacgtc       180
     cccgcgctcg cggaggtgtg cgcgagatac gacgtcggcg ccgtgatacc gctgaccgac       240
     ctcgacatcg aggtgctcgc gcaggcgcgc gccgacggga tcctgcccgc gttcgtgccc       300
     gaccccgaga tcgcccgcgc gacgtacgac aagtacgagg cgcacctgct gctggagtcg       360
     cacgggctgc cgtcgccgcc gacggtcctg cccggcgagc agccggagtc ctacccggtg       420
     atggtgaagc cgcgccaggg ctccggcgcg cgctcgatcc atctcgcgca cgacgccgag       480
     gaggcggcct tcttcgtcag atacgtgaag gagccgacga tggtgcagcg cgcgatggac       540
     ggcccggagt tctcgatcga cctgctgtcc gacctcgacg gccgctgcct caacgcgatc       600
     ccgcgcacga tgctggagtc gcgcggcggc gagtcgatca agggcaccgt gatcgcggac       660
     agagagctga tcgacctcgg cgtcaacgtc gtcgagacgc tcggcgtgcg cggaccctgc       720
     accgtccagg cgttccgcga ccgggagatc ggcctcggca tcacggacgt caacacgcgc       780
     ttcggcggcg ccttccccgg ccccacgtac gcgacgctcg cggccggccg cacctatccg       840
     gagctgatcg cgcggatggc gaacggcgag cggatcgcgc cgcacgtcgg cgagttcgac       900
     gccggccgca ccttcacccg ctactactgg cagctcgagc tggacgccga gatgcagccg       960
     accggccgcg agctggtccc cggcggcgcg ccgccgccgc gttga                      1005
//

If you have problems or comments...

PBIL Back to PBIL home page