(data stored in ACNUC7421 zone)

EMBL: CP001854.PE99

CP001854.PE99        Location/Qualifiers
FT   CDS_pept        complement(95542..97200)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cwoe_0099"
FT                   /product="N-acetylmuramoyl-L-alanine amidase family 2"
FT                   /note="PFAM: N-acetylmuramoyl-L-alanine amidase family 2;
FT                   SMART: Animal peptidoglycan recognition protein PGRP;
FT                   N-acetylmuramoyl-L-alanine amidase family 2; KEGG: PGRPS3;
FT                   peptidoglycan recognition protein short class
FT                   (AGAP006342-PA); K01446 N-acetylmuramoyl-L- alanine
FT                   amidase"
FT                   /db_xref="EnsemblGenomes-Gn:Cwoe_0099"
FT                   /db_xref="EnsemblGenomes-Tr:ADB48535"
FT                   /db_xref="GOA:D3F4V7"
FT                   /db_xref="InterPro:IPR002502"
FT                   /db_xref="InterPro:IPR006619"
FT                   /db_xref="InterPro:IPR015510"
FT                   /db_xref="InterPro:IPR036505"
FT                   /db_xref="UniProtKB/TrEMBL:D3F4V7"
FT                   /inference="protein motif:PFAM:PF01510"
FT                   /protein_id="ADB48535.1"
FT                   /translation="MLRSVLLAALFALAASAPAVASVASGGAVDFEQPLPPTAAFAASG
FT                   DGPTATPAIAAPRPFDLLGLRWRGGEAHVEARVQRADGRWSRWQELPHAEDVAAGSRRG
FT                   ETVTGPLWTGRAQRYQLRGAHDTALPAGLRAHFVAVERSGATAPPRPAKASVDAPAIVP
FT                   RSQWDPTGSCAPRTPPRYGRVDFSVVHHTESLTSYSRAQAPEVVLGICRFHRNGNGWLD
FT                   IGYNLLVDRFGTVYEGRVGGVEQPVIGAHAGGWNSLSTGVAVIGSFTGSRPPQAAQDAL
FT                   TQVLAWKLQLAGVPAQGTIGEISPGGAENRWSSGTRVAFQRIAGHRDADHTDCPGGAFY
FT                   ALLPRLRGQTANQHEIAADLLTNSPVGGVLSQGGPAALTGRLALAGGQRPVGAPLTLQQ
FT                   RTGEDWSDLDELRTRVDGVWSASLPVTVNGTYRVVSDARGVASPGVRVEVAAGVTARVS
FT                   PQLLRPGRTVTLRGASTPAKERVTVVVERQTRRGAWRRVRRLSLATDAGSYETTLVLAA
FT                   PGVHRFLVTTAADAANAAGAAPVRTASVRRARRAR"
     atgctccgat ccgtcctgct cgccgcgctg ttcgcgctcg cggcgagcgc cccagccgtc        60
     gcctccgtcg cctccggcgg cgcggtcgac ttcgaacagc cgctgccgcc caccgccgcc       120
     ttcgccgcgt cgggcgacgg gcccaccgcc acgccggcga tcgccgcgcc gcggccgttc       180
     gacctgctcg ggctgcgctg gcgcggcggc gaggcgcacg tcgaagcgcg cgtgcagcgc       240
     gccgacgggc gctggagccg ctggcaggag ctgccgcacg cggaggacgt cgccgccggg       300
     tcgcggcgcg gcgagacggt gaccggaccg ctgtggaccg ggcgggcgca gcgctaccag       360
     ctgcgcggag cgcacgacac ggcgctgccg gcgggcctgc gcgcccactt cgtcgcggtc       420
     gaacggagcg gtgcgacggc gccgccacgg ccggcgaagg cgtcagtcga cgcaccggcg       480
     atcgtgccgc gctcgcaatg ggacccgacc ggctcgtgcg cgccgcggac cccgccgcgc       540
     tacggccgcg tcgacttctc cgtcgtccac cacaccgagt cgctgacgag ctacagccgt       600
     gcgcaggcgc cggaggtcgt gctcggaatc tgtcgcttcc accgcaacgg caacggctgg       660
     ctcgacatcg gctacaacct gctcgtcgac cgcttcggga ccgtctacga gggccgcgtc       720
     ggcggcgtcg agcagcccgt gatcggcgcc cacgccggcg gctggaacag cctctcgacc       780
     ggcgtcgcgg tgatcggcag cttcaccggc tcgcgcccgc cgcaggccgc acaggacgcg       840
     ctcacgcagg tgctcgcgtg gaagctgcag ctcgccggcg tgccggcgca gggcacgatc       900
     ggcgagatct cgccgggcgg cgccgagaac cgctggagca gcggcacgcg tgtggccttc       960
     cagcgaatcg ccggccaccg cgacgccgac cacaccgact gccccggcgg cgcgttctac      1020
     gcgctgctgc cgcgcctgcg cggacagacg gccaaccagc atgagatcgc ggccgacctg      1080
     ctgacgaact cgcccgtcgg cggcgtgctc agccagggcg gacccgcggc gttgaccggc      1140
     cggctcgcgc tcgcgggcgg acagcggccc gtcggcgcgc cgttgacgtt gcagcagcgc      1200
     acgggcgagg actggtccga cctcgacgag ctgcgcacgc gggtcgacgg cgtctggtcg      1260
     gcctcgctcc cggtcaccgt caacggcacc taccgcgtcg tctccgacgc gcgcggcgtc      1320
     gcatcgcccg gcgtgcgggt cgaggtcgcg gcgggtgtga ccgcgcgggt ctcgccgcag      1380
     ctgctgcgac ccggcagaac ggtgacgctg cgcggcgcga gcacgccggc gaaggaacgt      1440
     gtgacggtcg tcgtcgagcg ccagacgaga cgcggcgcct ggagacgtgt ccgccggctg      1500
     tcgctcgcga ccgacgccgg cagctacgag acgacgcttg tgctcgccgc gccaggcgtc      1560
     caccgcttcc tcgtcacgac cgccgccgac gccgcgaacg cggccggcgc cgcgccggta      1620
     cggacggcga gcgtgcggcg ggcgagaaga gcgcgatag                             1659
//

If you have problems or comments...

PBIL Back to PBIL home page