(data stored in SCRATCH zone)

EMBL: CP001875.ARGI

CP001875.ARGI        Location/Qualifiers
FT   CDS_pept        complement(571657..572664)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="argI"
FT                   /locus_tag="PANA_0489"
FT                   /product="ArgI"
FT                   /note="Ornithine carbamoyltransferase; Similar to Pantoea
FT                   sp. At-9b, ornithine carbamoyltransferase (NCBI:
FT                   ZP_05730025.1); COG: Amino acid transport and metabolism;
FT                   Subcellular localization as predicted by Psort 2.0:
FT                   Cytoplasmic"
FT                   /db_xref="EnsemblGenomes-Gn:PANA_0489"
FT                   /db_xref="EnsemblGenomes-Tr:ADD75656"
FT                   /db_xref="GOA:D4GIR1"
FT                   /db_xref="InterPro:IPR002292"
FT                   /db_xref="InterPro:IPR006130"
FT                   /db_xref="InterPro:IPR006131"
FT                   /db_xref="InterPro:IPR006132"
FT                   /db_xref="InterPro:IPR024904"
FT                   /db_xref="InterPro:IPR036901"
FT                   /db_xref="UniProtKB/TrEMBL:D4GIR1"
FT                   /protein_id="ADD75656.1"
FT                   /translation="MSQLYQRHFLRLLDFTPAEIDYLLTLSAELKRAKKTASETQYLKG
FT                   KNIALIFEKDSTRTRCSFEVAAYDQGANVTYLGPSGSQIGHKESMKDTARVLGRMYDGI
FT                   QYRGYGQALVETLAEHAGVPVWNGLTTEFHPTQLLADLLTMQEHLPGKPLSEMTLVYVG
FT                   DARNNMGNSMLEAAAQVGLDLRMVAPQSCWPEADLVAQCRQVAEQTGGKITLTADIAEG
FT                   VKGADFIYTDVWVSMGEAKAVWEERIALLRDYQVNHAMLALTGNPQVKFLHCLPAFHDD
FT                   QTTLGRQMAEQYGLQDGMEVSNDVFESAHSIVFDQAENRMHTIKAVMVATLGQR"
     atgagtcagt tgtatcaacg tcatttcctc aggctgctgg attttacccc ggctgagatt        60
     gactacttgc ttaccctgtc cgccgaatta aaacgcgcaa aaaaaaccgc cagtgaaacc       120
     cagtacctga aaggcaaaaa catcgcgctc atcttcgaaa aagactcgac ccgtacccga       180
     tgctctttcg aagttgccgc ttacgatcag ggggcaaacg tcacttacct cggcccaagc       240
     ggcagccaga tcggccataa agagtcgatg aaagacaccg cgcgcgtgtt aggccgcatg       300
     tatgacggta ttcagtatcg gggttacggt caggcactgg tcgaaaccct ggcggaacat       360
     gctggcgtgc cggtgtggaa cggcctgacc accgagttcc atccaacgca gctgctggcc       420
     gatctgctga ccatgcagga gcatctgcca ggcaagccgc tcagtgagat gaccctggtg       480
     tacgtgggcg atgctcgcaa caatatgggt aacagcatgc tggaagcggc ggcacaggtt       540
     ggcttagatc tgcgtatggt cgcgccgcaa agctgctggc cggaagccga cctggtggct       600
     cagtgccgtc aggttgccga acagaccggc ggcaaaatca ccctgacggc agatattgct       660
     gagggcgtga aaggcgccga tttcatctat accgacgtct gggtttccat gggtgaagcc       720
     aaagcagtgt gggaagaacg tattgccctg ctgcgcgact atcaggtcaa tcacgcgatg       780
     ctcgcgctga ccggcaatcc gcaggtgaaa ttcctgcact gcttaccggc cttccatgac       840
     gatcagacca cgctgggccg tcagatggcg gaacagtacg gcctgcagga tggcatggag       900
     gtcagtaatg acgtctttga gtcggcgcac agcatcgtat tcgatcaggc ggaaaaccgg       960
     atgcacacca ttaaagcggt gatggtcgcc acgctgggac agcgctaa                   1008
//

If you have problems or comments...

PBIL Back to PBIL home page