(data stored in SCRATCH zone)

EMBL: CP001875.ATPB

CP001875.ATPB        Location/Qualifiers
FT   CDS_pept        22709..23527
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="atpB"
FT                   /locus_tag="PANA_0021"
FT                   /product="AtpB"
FT                   /note="ATP synthase a chain; Similar to Pantoea sp. At-9b,
FT                   ATP synthase F0, A subunit (NCBI: ZP_05729609.1); COG:
FT                   Energy production and conversion; Subcellular localization
FT                   as predicted by Psort 2.0: Inner Membrane"
FT                   /db_xref="EnsemblGenomes-Gn:PANA_0021"
FT                   /db_xref="EnsemblGenomes-Tr:ADD75188"
FT                   /db_xref="GOA:D4GFS4"
FT                   /db_xref="InterPro:IPR000568"
FT                   /db_xref="InterPro:IPR023011"
FT                   /db_xref="InterPro:IPR035908"
FT                   /db_xref="UniProtKB/TrEMBL:D4GFS4"
FT                   /protein_id="ADD75188.1"
FT                   /translation="MAAGEISTPQEYIGHHLTHLQLDLRTFELVNAHDAPATFWVLNID
FT                   SMFFSLVLGVIFLVLFRSVAKSVTSGVPGKMQAAIELVVGFVDSNVRDMYHGKSKLIAP
FT                   LALTIFVWVFLMNFMDLLPIDLLPYIGEHWLGLPALRVVPSADVNITLSMALGVFILIL
FT                   FYSIKMKGIGGFTKELTLQPFNHPIFIPINLILEGVSLLSKPVSLGLRLFGNMYAGELI
FT                   FILIAGLLPWWSQWILNVPWAIFHILIISLQAFIFMVLTIVYLSMASEEH"
     atggctgcag gagaaatctc tactccgcaa gagtacattg gtcaccacct gactcatctt        60
     cagttggacc tgcgtacctt cgagttagtg aatgctcacg acgctcccgc gacgttctgg       120
     gtattaaata tcgattccat gtttttctct ctggtgctgg gagttatctt cctggtgttg       180
     ttccgtagcg tggcgaaaag cgtcaccagc ggtgtgccag ggaaaatgca ggcggctatc       240
     gaactggttg tcggtttcgt tgatagcaac gtgcgcgaca tgtatcacgg taagagcaaa       300
     cttatcgccc cgctggctct gacgattttt gtctgggtct tcttgatgaa cttcatggat       360
     ctgctgccaa tcgatttgct gccctatatt ggtgagcact ggttggggtt accggcgctg       420
     cgcgtggtac cttctgcaga cgtgaacatc acgctatcca tggcgttggg cgtatttatt       480
     ttgattctgt tctacagcat caaaatgaaa ggcattggcg gcttcacgaa agagctgacg       540
     ctgcagcctt ttaatcaccc gatctttatc cccatcaacc ttattctgga aggtgttagc       600
     ctgctgtcca aaccggtttc actcggtctg cgactgttcg gtaacatgta tgcgggtgaa       660
     ctgatcttta tccttattgc cggtctgttg ccgtggtggt cacagtggat tctgaatgtg       720
     ccttgggcca ttttccacat cctgatcatt tcgctacagg ctttcatctt catggtcctc       780
     acgattgtct atctgtcgat ggcatctgaa gaacattga                              819
//

If you have problems or comments...

PBIL Back to PBIL home page