(data stored in SCRATCH zone)

EMBL: CP001875.ATPD

CP001875.ATPD        Location/Qualifiers
FT   CDS_pept        27419..28840
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="atpD"
FT                   /locus_tag="PANA_0027"
FT                   /product="AtpD"
FT                   /note="ATP synthase beta chain; Similar to Pantoea sp.
FT                   At-9b, ATP synthase F1, beta subunit (NCBI: ZP_05729615.1);
FT                   COG: Energy production and conversion; Subcellular
FT                   localization as predicted by Psort 2.0: Unknown"
FT                   /db_xref="EnsemblGenomes-Gn:PANA_0027"
FT                   /db_xref="EnsemblGenomes-Tr:ADD75194"
FT                   /db_xref="GOA:D4GFT0"
FT                   /db_xref="InterPro:IPR000194"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004100"
FT                   /db_xref="InterPro:IPR005722"
FT                   /db_xref="InterPro:IPR020003"
FT                   /db_xref="InterPro:IPR024034"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036121"
FT                   /db_xref="UniProtKB/TrEMBL:D4GFT0"
FT                   /protein_id="ADD75194.1"
FT                   /translation="MELGRGFKMAAGKIVQIIGAVVDVEFPQDAVPQVYSALEVKNGDA
FT                   RLVLEVQQQLGGGVVRTIAMGTSDGLKRGLEVTDLKKPIQVPVGKATLGRIMNVLGEPI
FT                   DMKGDLTEEDGSAVEVSSIHRPAPSYEDQSNSQELLETGIKVIDLMCPFAKGGKVGLFG
FT                   GAGVGKTVNMMELIRNIAAEHSGYSVFAGVGERTREGNDFYHEMTDSNVIDKVALVYGQ
FT                   MNEPPGNRLRVALTGLTMAEKFRDEGRDVLLFIDNIYRYTLAGTEVSALLGRMPSAVGY
FT                   QPTLAEEMGVLQERITSTKTGSITSVQAVYVPADDLTDPSPATTFAHLDSTVTLSRQIA
FT                   SLGIYPAVDPLDSTSRQLDPLVVGQEHYDVARGVQSLLQRYQELKDIIAILGMDELSEE
FT                   DKLLVARARKIQRFLSQPFFVAEVFTGSPGKYVTLKDTIRGFKGIMEGEFDHLPEQAFY
FT                   MVGAIEEAVEKAKKL"
     ttggaattag gtagaggatt caagatggca gctggaaaga ttgtccagat tatcggcgcc        60
     gtagttgacg tcgaattccc tcaggatgca gtaccgcaag tgtacagcgc tcttgaggtt       120
     aagaatggtg atgctcgtct ggtgctggaa gttcagcagc agctgggtgg tggcgtggtt       180
     cgtactatcg ccatgggtac ttctgacggc ctgaagcgcg gtctggaagt caccgacctg       240
     aaaaaaccga tccaggtacc ggttggtaaa gcaaccctcg gccgtatcat gaacgtgctg       300
     ggcgagccta tcgacatgaa aggcgacctg acagaagaag acggcagcgc agtagaggtt       360
     tcctctattc accgccctgc gccttcttat gaagatcagt ctaactcgca ggaactgctg       420
     gaaaccggca tcaaggttat cgacctgatg tgtccgttcg ctaagggcgg taaagtcggt       480
     ctgttcggtg gtgcgggtgt aggtaaaacc gtaaacatga tggagctgat ccgtaacatt       540
     gcggctgagc actcaggtta ctcggtattt gccggcgtgg gtgagcgtac tcgtgagggt       600
     aacgacttct accacgaaat gactgactcc aacgttatcg ataaagttgc gctggtgtat       660
     ggccagatga acgagccgcc gggtaaccgt ctgcgcgtgg cactgaccgg tctgaccatg       720
     gcggagaaat tccgtgatga aggccgcgac gttctgctgt tcatcgacaa catctaccgt       780
     tataccctgg ccggtacgga agtatccgcg ctgctgggtc gtatgccatc tgcggtaggt       840
     tatcagccaa cgctggcaga agagatgggt gtgttgcagg agcgtattac ctccaccaag       900
     acaggttcaa tcacctccgt acaggccgta tacgtgccag cggatgactt gactgacccg       960
     tcaccagcaa ccacctttgc tcacttagac tcaacagtta ccctgagccg tcagatcgcc      1020
     tcgctgggta tctacccggc cgttgacccg ctggactcca ccagccgtca gctggatcca      1080
     ctggttgtgg gtcaggagca ctacgacgtt gcacgtggcg tacagtcact gctgcagcgt      1140
     tatcaggaac tgaaagacat catcgccatc ctgggtatgg acgagctgtc tgaagaagac      1200
     aaactgctgg tggcacgtgc gcgtaagatt cagcgcttcc tgtctcagcc gttcttcgta      1260
     gcagaagtgt tcaccggttc tccaggtaaa tacgtaacgc tgaaagacac catccgtggc      1320
     tttaaaggca tcatggaagg tgaatttgac cacctgccag agcaggcctt ctacatggtt      1380
     ggcgccatcg aagaagcggt cgaaaaagcg aagaaactgt aa                         1422
//

If you have problems or comments...

PBIL Back to PBIL home page