(data stored in SCRATCH zone)

EMBL: CP001875.AVTA

CP001875.AVTA        Location/Qualifiers
FT   CDS_pept        83012..84262
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="avtA"
FT                   /locus_tag="PANA_0078"
FT                   /product="AvtA"
FT                   /note="Valine--pyruvate aminotransferase; Similar to
FT                   Pantoea sp. At-9b, aminotransferase class I and II (NCBI:
FT                   ZP_05729654.1); COG: Amino acid transport and metabolism;
FT                   Subcellular localization as predicted by Psort 2.0:
FT                   Unknown"
FT                   /db_xref="EnsemblGenomes-Gn:PANA_0078"
FT                   /db_xref="EnsemblGenomes-Tr:ADD75245"
FT                   /db_xref="GOA:D4GFY1"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:D4GFY1"
FT                   /protein_id="ADD75245.1"
FT                   /translation="MAFSQFGDKFTQHSGISRLMEDMGAGLRTPGTIMLGGGNPAQIPE
FT                   MNDYFQQLLQHMHDEGKLSEALCNYDGPRGKAVLLDALATMLREQLGWSITAQNIALTN
FT                   GSQSAFFYLFNLFAGRRSDGSKKRVLFPLAPEYLGYADAGLDDDLFISAKPNIELLPEG
FT                   QFKYHVDFEHLPMNDDVGLICVSRPTNPTGNVITDDELLKLDVLAQQHEVPLLIDNAYG
FT                   VPFPGIIFSDVRPLWNPNIILCMSLSKLGLPGARCGIIIADESTITAISNMNGIISLAP
FT                   GSIGPAIACEMIQRGDLLRLSEGVIKPFYQRKVMETINIIRRYLPAERCLIHKPEGAIF
FT                   LWLWFRDLPISTELLYQRLKARGVLMVPGHFFFPGLEHDWPHTHQCMRMNYVPDAENIE
FT                   RAVQILAEEVEHAWRDS"
     atggcctttt ctcagttcgg cgacaaattt actcagcatt ccggcatctc acgtctgatg        60
     gaagacatgg gtgcaggctt acgcacgcca ggcactatca tgcttggcgg tggcaatccc       120
     gcgcagattc cggagatgaa cgactatttt cagcagttgc tgcagcatat gcacgatgaa       180
     ggcaaactga gtgaggcctt gtgtaattac gatggccctc gcggcaaggc ggtgctgttg       240
     gatgcgctgg cgacgatgtt gcgagagcaa ctgggctggt ctatcactgc acagaacatc       300
     gccctgacca acggcagcca gagcgcgttt ttctatctgt ttaacctgtt tgcagggcgc       360
     cgcagtgacg gcagcaaaaa acgcgtgctg ttccctctgg cccccgaata tctgggctat       420
     gccgatgcgg gtctggatga cgatctgttt atttcggcca agccgaatat tgagttactg       480
     ccggaagggc agtttaagta ccacgtcgat tttgaacatt tgcccatgaa tgatgacgtc       540
     ggcctgattt gtgtatcacg cccgacgaat ccaaccggta acgtgattac cgatgacgaa       600
     ctgttgaagc tggatgtgct ggcgcagcag catgaggttc cgctgctgat cgacaatgcc       660
     tatggcgtcc cctttccggg cattattttc agcgatgtcc ggcctttgtg gaaccccaat       720
     atcattctct gcatgagcct gtccaaactc ggcctgcctg gcgcgcgctg cggaattatc       780
     atcgctgatg aaagtaccat cacggcgatt agtaacatga acggcattat cagcctggca       840
     ccgggcagta ttgggcccgc tatcgcctgt gaaatgatcc agcgtggcga tctgttgcgg       900
     ctgtctgaag gggtgatcaa acccttctac cagcgcaagg tcatggagac gattaacatt       960
     attcgtcgtt atttgcccgc agaacgttgt ctgatacata aacccgaagg ggcgattttc      1020
     ctgtggttat ggttccgcga tttgccgatc agcacggagc tgctgtatca acggcttaag      1080
     gcgcgaggcg tactgatggt gcccgggcac tttttcttcc cggggctgga acatgactgg      1140
     ccgcacacgc atcagtgcat gcgtatgaac tacgtgccgg atgcggaaaa tattgaacga      1200
     gccgtacaga ttcttgcaga ggaagtggag cacgcctggc gggacagtta g               1251
//

If you have problems or comments...

PBIL Back to PBIL home page