(data stored in SCRATCH zone)

EMBL: CP001875.BGLA

CP001875.BGLA        Location/Qualifiers
FT   CDS_pept        complement(67217..68599)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bglA"
FT                   /locus_tag="PANA_0062"
FT                   /product="BglA"
FT                   /note="Beta-glucosidase A; Similar to Citrobacter sp. 30_2,
FT                   conserved hypothetical protein (NCBI: ZP_04559465.1); COG:
FT                   Carbohydrate transport and metabolism; Subcellular
FT                   localization as predicted by Psort 2.0: Cytoplasmic"
FT                   /db_xref="EnsemblGenomes-Gn:PANA_0062"
FT                   /db_xref="EnsemblGenomes-Tr:ADD75229"
FT                   /db_xref="GOA:D4GFW5"
FT                   /db_xref="InterPro:IPR001360"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR018120"
FT                   /db_xref="UniProtKB/TrEMBL:D4GFW5"
FT                   /protein_id="ADD75229.1"
FT                   /translation="MNYRFPENFWWGSASSALQAEGDSLNGGKSPTTWDRWFAQQPHRF
FT                   HQGIGPQDTSGFYQHWQHDIALLKQLGHNSFRTSLSWARLMPDGTDAVNPDAVAFYNKV
FT                   IDALLAQGITPFITLFHFDMPLAMQDKGGWENREVVEAFGRYAQRCFALFGHKVKHWFT
FT                   FNEPIVPVEGGYLYDFHYPNVVDFRRAANVALHTVLAHALAVRAWRNGGYDGDIGVVLN
FT                   LTPSYSRSANPADVQAAHHADLLFNRSFLDPVLKGEYPVDLLSLLSQYHQLPRCQPGDA
FT                   ALIADGIIDLLGVNYYQPRRVKCRDSAVNAEAPFMPEWLFDHYEMPGRQMNPYRGWEIY
FT                   APGIYDILTNLRVNYGNPRCFISENGMGVENEQRFIQNGEILDDYRIEFVSEHLKWLHK
FT                   GIREGCHCLGYHMWTFIDNWSWLNGYKNRYGFVQLDLATQKRTIKKSGKWFAEVAENNG
FT                   FN"
     atgaactacc gttttcctga aaatttctgg tggggcagcg ccagctcggc gttacaagcc        60
     gaaggggaca gcctgaatgg cggtaaaagc cctaccacct gggatcgctg gtttgcacaa       120
     cagcctcacc gtttccatca aggcattggc ccacaagaca cctcgggctt ttatcagcac       180
     tggcagcacg atatcgcatt actaaagcag ttagggcaca acagctttcg cacgtcgctg       240
     agctgggcgc gcctgatgcc agacggcact gacgccgtga atcctgacgc cgtggctttt       300
     tataacaagg tcatcgatgc attactggcg cagggcatta caccgtttat caccctgttt       360
     catttcgata tgcctctggc tatgcaggac aaaggcggct gggagaaccg tgaggttgtg       420
     gaggcatttg gccgctatgc ccagcgctgt ttcgcgctgt tcggccataa ggtgaaacac       480
     tggtttacct tcaatgaacc gattgtgccg gtcgaaggtg gctatctgta cgattttcat       540
     tatcccaacg ttgtggactt cagacgagcg gctaacgtgg ccttgcacac agtcctggca       600
     cacgcgctgg cagtacgcgc ctggcgtaac ggcggctacg acggtgacat tggtgtggtg       660
     ctgaacctca cgccgtccta ttcacgatcg gcgaatccgg ccgatgtgca agccgcacat       720
     catgctgacc tgttgtttaa ccgtagcttt ctggatccgg ttctgaaggg agaatatccc       780
     gtggatctgc tgagcttact gagtcagtac caccagcttc cgcgctgcca gcctggcgac       840
     gctgcgttga ttgccgacgg cattatcgac cttctgggcg tgaactatta tcagccgcgc       900
     cgggtaaagt gtcgggacag cgccgtcaat gctgaagcgc cctttatgcc ggagtggtta       960
     ttcgaccact atgaaatgcc aggccgtcag atgaacccgt atcgtggatg ggaaatttac      1020
     gcgcccggta tttacgatat tctgactaac ctgcgggtta attatggaaa cccgcgctgt      1080
     tttatttctg aaaatggtat gggcgttgag aatgaacagc gatttattca gaacggtgaa      1140
     attctggatg attatcgtat cgaatttgtt tccgaacatc ttaaatggct gcataaaggg      1200
     attcgcgaag gctgtcattg cctgggttat catatgtgga catttattga taactggtca      1260
     tggctaaacg gttataaaaa tcgttacggt tttgtgcagt tagatttagc cacgcaaaaa      1320
     cgtacgatta aaaagagtgg caaatggttt gctgaggttg ccgaaaataa cggttttaat      1380
     tga                                                                    1383
//

If you have problems or comments...

PBIL Back to PBIL home page