(data stored in SCRATCH zone)

EMBL: CP001875.DEGQ

CP001875.DEGQ        Location/Qualifiers
FT   CDS_pept        complement(480709..482184)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="degQ"
FT                   /locus_tag="PANA_0410"
FT                   /product="DegQ"
FT                   /note="Protease DegQ precursor; Similar to Pantoea sp.
FT                   At-9b, protease Do (NCBI: ZP_05730849.1); COG:
FT                   Posttranslational modification, protein turnover,
FT                   chaperones; Subcellular localization as predicted by Psort
FT                   2.0: Periplasmic"
FT                   /db_xref="EnsemblGenomes-Gn:PANA_0410"
FT                   /db_xref="EnsemblGenomes-Tr:ADD75577"
FT                   /db_xref="GOA:D4GI47"
FT                   /db_xref="InterPro:IPR001478"
FT                   /db_xref="InterPro:IPR001940"
FT                   /db_xref="InterPro:IPR009003"
FT                   /db_xref="InterPro:IPR011782"
FT                   /db_xref="InterPro:IPR036034"
FT                   /db_xref="UniProtKB/TrEMBL:D4GI47"
FT                   /protein_id="ADD75577.1"
FT                   /translation="MTLCPLFLRTPAANGCLIDLLPHFCSESVVAMKKQARLLSALALS
FT                   IGMSLAAAPGAMATLPAQIQSQPLPSLAPMLEKVLPAVVSVHVEGTQSDAQAQTQDIPE
FT                   PLKRFFGQLPGGAPSQPQPFEGLGSGVIIDAAKGYVLTNNHVVNGADKINVQLGDGSEY
FT                   DAKLIGHDEQTDIALIQIQGAKNLTQIKVADSDQLKVGDFAVAIGNPFGLGQTATSGII
FT                   SALGRSGLNLEGLENFIQTDAAINRGNSGGALVNLNGELIGINTAILASSGGNIGIGFA
FT                   IPSDMAMNLAEQLIKYGEVKRGQLGIKGTEMTADIAKAFNVDAQRGAFVSEVLPQSAAQ
FT                   KAGIKSGDIIVSVNDKPITSFAELRVKIGTTAPGEKVKLGLLREGKPVSVDVTLEQSAQ
FT                   TTASAQLLSPALQGATLSDGQTKTGDKGVKIDAIEKGTPAEQVGLQKDDVIIGVNRTRI
FT                   QNIAEMRKVLEAKPPVMALNVVRGEESIYLLLR"
     gtgacgctgt gcccgctgtt tttgcgaacc ccggccgcaa acggctgtct cattgattta        60
     ctcccccatt tttgcagcga gagcgttgta gcaatgaaaa aacaagcacg actgttaagc       120
     gcattagcct tgagtattgg aatgagtctt gccgctgcgc ccggcgcgat ggcgacgctg       180
     cctgcacaga ttcagagcca gccgcttccc agcctggcac cgatgctgga aaaagtgtta       240
     cctgctgtgg tcagcgtgca cgttgaaggc acccagtctg atgcccaggc ccagacacag       300
     gatattcccg agccgcttaa gcgtttcttt ggccagttgc caggtggcgc cccaagccag       360
     cctcaaccct ttgaggggct ggggtccggt gtcattattg atgccgccaa aggctatgtt       420
     ctgactaata accacgtggt caacggcgcg gataagatca acgtccagct cggcgatggc       480
     agcgaatatg atgccaaact gattggtcac gatgagcaga ccgacatcgc ccttatccag       540
     attcagggcg cgaaaaacct gacgcagata aaagtcgccg attcggatca gctgaaagtc       600
     ggtgattttg ccgtggccat cggcaatcct tttggccttg gtcagacagc gacctccgga       660
     attatttcgg cactgggccg cagcggcctg aatctcgaag ggctggaaaa ctttatccag       720
     accgatgccg ccattaaccg cggtaactcg ggcggcgcgc tggttaatct gaacggcgag       780
     ctgatcggca ttaataccgc cattctggcc tccagtggcg gcaatatcgg cattggcttt       840
     gcgattccga gcgatatggc catgaacctg gccgagcagt taattaagta cggcgaagtc       900
     aaacggggtc agttgggtat caaaggtacc gagatgaccg cggacatcgc aaaagcgttt       960
     aacgttgacg cacagcgcgg cgcgttcgtt tctgaagtgc tgccccagtc tgcggcgcaa      1020
     aaagccggta tcaagtcagg cgatatcatt gtttcggtca acgataaacc gattaccagc      1080
     ttcgcagaac tgcgggtgaa gatcggcacg acggcaccag gtgagaaagt gaagcttggc      1140
     ctgctacgtg aaggtaaacc ggtgagtgtt gatgtcaccc ttgagcaaag cgcccagacg      1200
     acggcaagcg cacagctgct ttctccagcc ctgcagggcg cgactctgag cgatggtcag      1260
     accaaaaccg gtgataaagg cgtgaagatt gatgccatcg aaaaaggcac tccggctgaa      1320
     caggtcggcc tgcaaaaaga tgacgtgatc attggcgtca accgcacgcg aattcagaat      1380
     attgccgaaa tgcgcaaggt gctggaagcc aaaccgccgg tgatggcgct gaatgtggtt      1440
     cgtggtgagg aaagtatcta tctgttattg agataa                                1476
//

If you have problems or comments...

PBIL Back to PBIL home page