(data stored in SCRATCH zone)

EMBL: CP001875.DGKA

CP001875.DGKA        Location/Qualifiers
FT   CDS_pept        314680..315048
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dgkA"
FT                   /locus_tag="PANA_0255"
FT                   /product="DgkA"
FT                   /note="Diacylglycerol kinase; Similar to Salmonella
FT                   enterica subsp. enterica serovar Choleraesuis str. SC-B67,
FT                   diacylglycerol kinase (NCBI: YP_219102.1); COG: Cell
FT                   wall/membrane/envelope biogenesis; Subcellular localization
FT                   as predicted by Psort 2.0: Inner Membrane"
FT                   /db_xref="EnsemblGenomes-Gn:PANA_0255"
FT                   /db_xref="EnsemblGenomes-Tr:ADD75422"
FT                   /db_xref="GOA:D4GHA7"
FT                   /db_xref="InterPro:IPR000829"
FT                   /db_xref="InterPro:IPR033718"
FT                   /db_xref="InterPro:IPR036945"
FT                   /db_xref="UniProtKB/TrEMBL:D4GHA7"
FT                   /protein_id="ADD75422.1"
FT                   /translation="MTNNATGLNRIVKAAGYSWQGLRAAWQHEAAFRQEAVAAVVAIIL
FT                   ACWLDVDTVSRILMIGSVVLVIIVEVLNSAIEAVVDRTGQERHPLAGRAKDMGSAAVFI
FT                   AILLALFVWGTLLWSHLR"
     atgacaaata atgccaccgg ccttaaccgt attgtgaaag cggccggcta ttcatggcaa        60
     ggtctgcgtg ctgcctggca gcacgaagcc gcttttcgtc aggaagcggt tgccgcagtg       120
     gtggcgatta tcctggcctg ctggctggat gtcgatactg tttcgcgcat cctgatgatt       180
     ggttctgtcg tgctggtgat tattgtcgaa gtcctgaaca gcgcgataga agccgtggta       240
     gaccgcacag gccaggagcg tcatccgctt gccgggcggg caaaagacat gggatccgct       300
     gccgttttta tcgcaatatt actggccctt tttgtctggg gaacgctgct ttggtcgcat       360
     ttgcgataa                                                               369
//

If you have problems or comments...

PBIL Back to PBIL home page