(data stored in SCRATCH zone)

EMBL: CP001875.DNAN

CP001875.DNAN        Location/Qualifiers
FT   CDS_pept        complement(95034..96257)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaN"
FT                   /locus_tag="PANA_0089"
FT                   /product="DnaN"
FT                   /note="DNA polymerase III beta subunit; Similar to Pantoea
FT                   sp. At-9b, DNA polymerase III, beta subunit (NCBI:
FT                   ZP_05729636.1); COG: DNA replication, recombination and
FT                   repair; Subcellular localization as predicted by Psort 2.0:
FT                   Cytoplasmic"
FT                   /db_xref="EnsemblGenomes-Gn:PANA_0089"
FT                   /db_xref="EnsemblGenomes-Tr:ADD75256"
FT                   /db_xref="GOA:D4GGF5"
FT                   /db_xref="InterPro:IPR001001"
FT                   /db_xref="InterPro:IPR022634"
FT                   /db_xref="InterPro:IPR022635"
FT                   /db_xref="InterPro:IPR022637"
FT                   /db_xref="UniProtKB/TrEMBL:D4GGF5"
FT                   /protein_id="ADD75256.1"
FT                   /translation="MVVATIPRYFTLAVRLSNCVKKATTSKKISQISSEHYLRDAMKFI
FT                   VEREQLLKPLQQVSGPLGGRPTLPILGNLLMQVNEGSLLLTGTDLEMEMVARVALTQPH
FT                   ETGATTVPARKFLDICRGLPEGAEINVTLEGERMLVRSGRSRFSLSTLPASDFPNLDDW
FT                   QNEVEFTLPQATLKRLIEATQFSMAHQDVRYYLNGMMFETEGEELRTVATDGHRLAVCS
FT                   MPIGQALPSHSVIVPRKGVIELLRLLDGGDTPLQVQIGSSNIRAHVGDYIFTSKLVDGR
FT                   FPDYRRVLPKNPDKALEAGCDLLKQAFARAAILSNEKFRGVRLHITENQLKITANNPEQ
FT                   EEAEEMLDVSYTGSELEIGFNVSYVLDVLNALKCENVRLLLTDSVSSVQIEDVVSPAAA
FT                   YVVMPMRL"
     ttggtggtcg cgaccatacc acggtacttc acgcttgccg taagattgag caactgcgtg        60
     aagaaagcca cgacatcaaa gaagatttct caaatctcat cagaacatta tcttcgtgac       120
     gctatgaaat ttattgttga acgtgaacag ttgctaaagc cgctgcagca agtcagcggt       180
     ccgctaggcg gtcgcccgac gttgcctatc ctcggcaatc tgctgatgca ggttaatgaa       240
     ggatcgttgt tactaaccgg caccgatttg gaaatggaaa tggttgcacg ggttgcctta       300
     acccagccgc acgagacggg tgcgacgacc gttccggcac gcaaattcct ggatatttgc       360
     cgtggcctgc cggaaggggc ggagataaac gtgacgctgg aaggcgagcg catgttagtg       420
     cgttccggcc gtagccgttt ttcgctctct accctgcccg ccagcgactt cccaaatctg       480
     gatgactggc agaacgaggt ggaattcacc ctgcctcagg ccacgctaaa acgcctgatc       540
     gaagccacgc agttctctat ggcccatcag gacgtacgct actacctgaa tggcatgatg       600
     tttgagacgg aaggcgaaga gctgcgtacg gtcgccaccg acggtcaccg tctggcggtc       660
     tgctccatgc ccattggcca ggcgcttccc agccattcag tcattgtgcc gcgtaaaggg       720
     gttatcgagc tgttacgcct gctggacggc ggtgatacac cgcttcaggt gcagattggc       780
     agcagcaaca tccgcgcgca cgttggcgac tatattttta cctctaagct ggtggatggt       840
     cgcttcccgg attatcgtcg ggtgctgcca aaaaatccgg ataaagcgct ggaggcaggc       900
     tgcgatctgc tcaagcaggc ttttgcccgt gcggcgatcc tctctaatga gaaattccgc       960
     ggcgttcgtc tccatatcac cgaaaatcag ctaaaaatta ccgctaataa tcctgagcag      1020
     gaagaagcgg aagagatgct ggatgtcagc tataccggca gcgagctgga aattggcttc      1080
     aacgtcagtt acgtactgga tgtgctgaat gcacttaagt gcgagaatgt ccgcctgctg      1140
     ctgacggatt ccgtttcgag cgtgcagatt gaagatgtgg tgagtccggc agcggcctat      1200
     gtcgtcatgc cgatgcgttt gtag                                             1224
//

If you have problems or comments...

PBIL Back to PBIL home page