(data stored in SCRATCH zone)

EMBL: CP001875.DNAT

CP001875.DNAT        Location/Qualifiers
FT   CDS_pept        complement(73619..74269)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaT"
FT                   /locus_tag="PANA_0068"
FT                   /product="DnaT"
FT                   /note="Primosomal protein I; Similar to Pantoea sp. At-9b,
FT                   primosomal protein I (NCBI: ZP_05729665.1); COG: DNA
FT                   replication, recombination and repair; Subcellular
FT                   localization as predicted by Psort 2.0: Unknown"
FT                   /db_xref="EnsemblGenomes-Gn:PANA_0068"
FT                   /db_xref="EnsemblGenomes-Tr:ADD75235"
FT                   /db_xref="GOA:D4GFX1"
FT                   /db_xref="InterPro:IPR020917"
FT                   /db_xref="InterPro:IPR040480"
FT                   /db_xref="UniProtKB/TrEMBL:D4GFX1"
FT                   /protein_id="ADD75235.1"
FT                   /translation="MENLNAFSAIPRVKKGTISASALEILSGVRCKLTAGLFMSVKILT
FT                   STLIGLEAFRQDPLSALQQAEDGTLAVLENYTPVMYAITPARLARLLALEAAAQQPSDV
FT                   ALDDSLYDDVSATLHTPVGKFAMYDGWQPDADFTRQAAIWGVALSEPVTPAELAAFVAY
FT                   WQAEGRLFHHVQWQQKLARSLQMNRAANGGQPRRDITQLPNPDSTIPDGFRGE"
     gtggaaaacc tcaacgcttt ttcagcgatc ccgcgcgtta aaaaaggtac aatatccgct        60
     tctgcactgg aaattttatc cggtgttcgg tgtaagttaa ccgcaggtct tttcatgtca       120
     gtcaaaatct taacgtcaac gcttattggt cttgaggctt tccgtcagga tccgctcagc       180
     gccttgcagc aggctgaaga cggcacgctg gcggtgctgg aaaattatac gcccgtaatg       240
     tatgccatta cgccagcgcg cctcgcgcgg ctactggcac ttgaggccgc cgcccagcaa       300
     cccagtgatg tggcgctgga cgacagcctg tatgacgatg tttctgctac gctgcatacg       360
     ccggtgggta aattcgccat gtatgatggc tggcagccgg acgctgactt tacgcgacag       420
     gcggccatct ggggcgttgc gctaagcgaa ccggtgacgc cagctgaact ggctgccttt       480
     gtggcctact ggcaggcgga agggcgtttg tttcatcacg tgcagtggca gcagaagctg       540
     gcacgcagcc tgcaaatgaa tcgggcggcc aatggcggac aacccagacg tgacattaca       600
     cagttgccaa atcctgacag cacaattcct gatggtttcc ggggtgaata a                651
//

If you have problems or comments...

PBIL Back to PBIL home page