(data stored in SCRATCH zone)

EMBL: CP001875.DPPB

CP001875.DPPB        Location/Qualifiers
FT   CDS_pept        134369..135436
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dppB"
FT                   /locus_tag="PANA_0122"
FT                   /product="DppB"
FT                   /note="Dipeptide transport system permease protein DppB;
FT                   Similar to Pantoea sp. At-9b, Alkaline phosphatase (NCBI:
FT                   ZP_05732363.1); COG: Amino acid transport and metabolism;
FT                   Subcellular localization as predicted by Psort 2.0: Inner
FT                   Membrane"
FT                   /db_xref="EnsemblGenomes-Gn:PANA_0122"
FT                   /db_xref="EnsemblGenomes-Tr:ADD75289"
FT                   /db_xref="GOA:D4GGI8"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:D4GGI8"
FT                   /protein_id="ADD75289.1"
FT                   /translation="MLSLARARGKRLRITPMLQFILRRLGLVIPTFIGITLLTFAFVHM
FT                   IPGDPVLIMAGERGISPERHAELMAMMGLDQPLWKQYLHYIYGVLHGDLGISLKSRIPV
FT                   WTEFVPRFKATLELGICAMMFAVCVGIPVGVMAAVKRGSVFDHTAVGISLTGYSMPIFW
FT                   WGIMLIMLVSVQLNLTPVSGRVADTVFLDDSHPLTGFMLIDTLIWGEPGDFKDAVMHMI
FT                   LPAIVLGTIPLAVIVRMTRSSMLEVLGEDYIRTARAKGLTRMRVIVIHALRNAMLPVVT
FT                   VIGLQVGTLLAGAILTETIFSWPGLGRWLIEALQRRDYPVVQGGVLLTAILIILVNLLV
FT                   DLLYGVVNPRIRHKK"
     atgttatctc tggccagggc caggggaaaa cgactgagaa ttacgcctat gctgcagttc        60
     atactccggc gtctggggct tgtcatccca acgttcatcg gtattacatt attgaccttc       120
     gcgtttgtgc acatgattcc gggcgatccg gtgcttatca tggcaggcga gcgcggtatt       180
     tcccctgagc gccatgctga attgatggcg atgatggggc tcgatcaacc gctgtggaag       240
     cagtatctgc actatatcta tggcgttctg catggggatt taggcatttc actgaaaagc       300
     cgcattcctg tgtggaccga atttgttccg cgctttaaag ccacacttga gctgggcatc       360
     tgcgccatga tgtttgccgt atgcgtaggg atcccggtcg gcgtcatggc tgcggtgaaa       420
     cgtggctcgg tgtttgatca taccgcggtg ggcatttcac tgaccggcta ctcgatgccg       480
     attttttggt ggggcatcat gctgattatg ctggtatctg ttcagcttaa tctcacgccc       540
     gtttccggac gtgttgcaga taccgtgttc ctggatgaca gccatccgct caccggtttc       600
     atgctgatcg atacgttaat ctggggtgag cctggcgact tcaaagatgc ggtcatgcat       660
     atgattctgc ccgctatcgt gctgggtacg attccgctgg cggtcatcgt acgtatgacg       720
     cgttcttcca tgctggaagt gctgggagaa gactatatcc gtacggcgcg tgcgaaaggc       780
     ctgacgcgta tgcgcgtcat tgtcattcac gcgctgcgta atgcgatgtt gccggttgtc       840
     accgttatcg gcctgcaggt cggtacgctg ctggcaggcg caatcctgac tgaaaccatt       900
     ttttcctggc cgggccttgg ccgttggtta atcgaagcgc tgcaacgccg tgactatccc       960
     gttgtgcagg gcggtgtgtt actgacggct attctgatca tcctggtcaa cctgctggtt      1020
     gatctgctgt atggcgtggt gaatccgcgc atacgccaca agaaataa                   1068
//

If you have problems or comments...

PBIL Back to PBIL home page