(data stored in SCRATCH zone)

EMBL: CP001875.DPPF

CP001875.DPPF        Location/Qualifiers
FT   CDS_pept        137319..138365
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dppF"
FT                   /locus_tag="PANA_0125"
FT                   /product="DppF"
FT                   /note="Dipeptide transport ATP-binding protein DppF;
FT                   Similar to Pantoea sp. At-9b, oligopeptide/dipeptide ABC
FT                   transporter, ATPase subunit (NCBI: ZP_05732366.1); COG:
FT                   Amino acid transport and metabolism; Subcellular
FT                   localization as predicted by Psort 2.0: Inner Membrane"
FT                   /db_xref="EnsemblGenomes-Gn:PANA_0125"
FT                   /db_xref="EnsemblGenomes-Tr:ADD75292"
FT                   /db_xref="GOA:D4GGJ1"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013563"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4GGJ1"
FT                   /protein_id="ADD75292.1"
FT                   /translation="MPGDQLMSPDNTKHEYLLQAIDLKKHYPVKKGLFGQERLVKALDG
FT                   VSFNLERGKTLAVVGESGCGKSTLGRLLTMIETPTEGQLYWHGQDLLKHDPHAQKLRRQ
FT                   KIQIVFQNPYGSLNPRKKVSQILEEPLVINTSLSKAERREKTLEMMAKVGLKTEHYDRY
FT                   PHMFSGGQRQRIAIARGLMLEPDVLIADEPVSALDVSVRAQVLNLMMDLQQEMGLSYVF
FT                   ISHDLSVVEHIADDVMVMYLGRCVEKGSKEAIFANPRHPYTQALLSATPRLNPDERRER
FT                   IKLTGELPSPLNPPPGCAFNARCRRRFGTCVQLQPQLKQYGDQQIACFAVDQDENQLTA
FT                   SVESASQP"
     atgccgggag accaacttat gagtcctgat aatacaaagc acgagtatct gctgcaggct        60
     atcgacctga aaaaacacta tccggtgaag aaaggattgt ttggtcagga acgcctggtt       120
     aaagcgctgg atggcgtctc ttttaatctg gagcgcggta aaacgctggc ggttgtcgga       180
     gagtctggct gcggtaaatc cacactgggc cgtttactca ccatgattga aacgccaaca       240
     gaaggacagc tttactggca cggtcaggat ttgttaaaac acgatcccca cgcccagaag       300
     ctgcgtcggc agaaaattca gatcgtcttt cagaatccgt atggttctct gaatccacgc       360
     aaaaaagtca gccagatcct ggaagagccg ctggttatca atacttcact cagtaaagcg       420
     gaacgtcgcg agaaaacgct ggagatgatg gccaaggtag gattgaaaac cgagcattac       480
     gatcgttatc ctcatatgtt ttcgggtggc caacgtcagc gtattgccat tgcccgtggc       540
     ctgatgcttg agccagacgt gctgattgct gacgagccgg tttcagcact ggacgtgtcc       600
     gtacgggcac aggtgcttaa tctgatgatg gatctgcagc aagagatggg gctgtcctat       660
     gtgttcattt ctcacgattt atccgtggtc gagcatatcg cagatgacgt gatggtgatg       720
     tacctggggc gctgcgtgga aaagggcagc aaagaggcga tttttgccaa tccacgtcat       780
     ccttacaccc aggcgctact ttctgccacg ccgcggctca atcctgatga gcgtcgtgaa       840
     cgtattaagc tgaccgggga actccccagc ccgctgaatc caccgcccgg ctgcgcattc       900
     aatgcccgct gtcggcgtcg ttttggcacc tgtgtccagc tgcagcccca actcaagcag       960
     tatggcgacc aacagatagc ctgcttcgcg gttgaccagg atgaaaacca gctaacggca      1020
     tcagtcgagt ctgccagcca gccttaa                                          1047
//

If you have problems or comments...

PBIL Back to PBIL home page