(data stored in SCRATCH zone)

EMBL: CP001875.FEOA

CP001875.FEOA        Location/Qualifiers
FT   CDS_pept        455375..455599
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="feoA"
FT                   /locus_tag="PANA_0383"
FT                   /product="FeoA"
FT                   /note="Ferrous iron transport protein A; Similar to
FT                   Escherichia coli E110019, ferrous iron transport protein A
FT                   (NCBI: ZP_03049762.1); COG: Inorganic ion transport and
FT                   metabolism; Subcellular localization as predicted by Psort
FT                   2.0: Unknown"
FT                   /db_xref="EnsemblGenomes-Gn:PANA_0383"
FT                   /db_xref="EnsemblGenomes-Tr:ADD75550"
FT                   /db_xref="GOA:D4GI20"
FT                   /db_xref="InterPro:IPR007167"
FT                   /db_xref="InterPro:IPR008988"
FT                   /db_xref="InterPro:IPR038157"
FT                   /db_xref="UniProtKB/TrEMBL:D4GI20"
FT                   /protein_id="ADD75550.1"
FT                   /translation="MQITPGTTYRIRGYQHSIHPAWRQKLLTMGMLPGTLIEVVRIAPL
FT                   GDPVQVRTRRVSLAVRQQDLASVMLEEIR"
     atgcaaatta caccaggtac aacctatcgc atcaggggat accaacattc tattcatccc        60
     gcctggcggc aaaaattatt aactatgggc atgttacccg gcacgctgat tgaggtcgtt       120
     cggatcgcac cgctgggcga tcccgtgcag gtccgcacgc gtcgcgtgag ccttgcggtc       180
     aggcagcagg acctggcgtc cgtcatgctg gaagaaatac gctga                       225
//

If you have problems or comments...

PBIL Back to PBIL home page