(data stored in SCRATCH zone)

EMBL: CP001875.GLTA

CP001875.GLTA        Location/Qualifiers
FT   CDS_pept        complement(488463..494123)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gltA"
FT                   /locus_tag="PANA_0418"
FT                   /product="GltA"
FT                   /note="Glutamate synthase [NADPH] large chain; Similar to
FT                   Pantoea sp. At-9b, Glutamate synthase (ferredoxin) (NCBI:
FT                   ZP_05730857.1); COG: Amino acid transport and metabolism;
FT                   Subcellular localization as predicted by Psort 2.0:
FT                   Unknown"
FT                   /db_xref="EnsemblGenomes-Gn:PANA_0418"
FT                   /db_xref="EnsemblGenomes-Tr:ADD75585"
FT                   /db_xref="GOA:D4GI55"
FT                   /db_xref="InterPro:IPR002489"
FT                   /db_xref="InterPro:IPR002932"
FT                   /db_xref="InterPro:IPR006982"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR017932"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="InterPro:IPR036485"
FT                   /db_xref="UniProtKB/TrEMBL:D4GI55"
FT                   /protein_id="ADD75585.1"
FT                   /translation="MRKTQSRRLSGAEMKEFALGSVQLNSVPETMQVMSKAVLRRPSMS
FT                   SKKPDSYGLYDPAAGSDSCGVGFITRKDGEQTHEILRMAHSALCTVPHRGGMSAEGVGD
FT                   GAGVNVDLSLHFFRKITGQALEAGRFGVGNFFVPKDTELRANAERLVEETLNRFNLPVI
FT                   LKREMPLDNSVTRPAAMQFQLPIVQWIFAAPQDISNQIDFEKLIYRALLTIEAQAFTQT
FT                   EFGGLYPLSLSSRTQVFKARLNSNEVIPYFKDLTDPDHHVRGLFFHTRFSTNTDPHTTM
FT                   AQPFRLMAHNGELNTDRKNRIAESALASARGKTIVRPKGQSDSSRLDQSIHSRLMEDDL
FT                   DLITAVVSMMPPAWENDTALSPAVRDMLEYFSLYEEKNDGPAALIFGNGEVIGARLDRL
FT                   GLRPLRSIETAEYIGAMSEAGQIAFPPESVLRRGRIEAGGMLYFDHREKRSYTTHQALE
FT                   KLAAEKDYAALLGKSRVDLRELPVIPAEQQGSPLRYRGDLKTYQRFVAYYYNQESFKFM
FT                   MDPMLNTGAEKISAMGYGNAINGLSDHEGGMAHYFSQRFAQVTNPPLDSIREADGMTLR
FT                   VALGAKPHLGRSKGRQIIVPTPILTHLDMLQLREQNVAPYARFEMLYEPVTGKDLLSRT
FT                   ANASALEKAIDDLAQQVVDFARSEGGIAVLTDRHISSTQAALPMLLVISAVNQRLVQEG
FT                   LRLDVSLVVESGQIISSHHIAATLGFGASAVYPLGVQMRAEEKFGEGEEGNKAFKRYAK
FT                   AAEKALMKTMGKVGLCTVESYSSGEFFEPNFLNTDDPVLRKYFPNIKTPVGGAGFATIA
FT                   QMAVDWHQSALKIQGESEVPLLGLFKERAEGAGHSYGTIAVRTFIDMTEEPIRFADKAR
FT                   EEDNFIRLMTLARLDNAFGIKPETFKDSSFERIPDEVMNDFAITADYRQFSSLMYEERK
FT                   RRPAALRDILAFPADLTHIDSEAEFRRKLGRYSLTNNGFATRGLVCDAIEGSQNAFMLR
FT                   LTDAIAGLKPESERLLNLSRALKARFNDEIETAEVVAGGLKVTASGKAADYLSRIFTAL
FT                   PSLPLSDIQPASEITRTFASGAMSHGALVAPAHEAVAHGTNMVGGMSNCGEGGEHYSRH
FT                   GTIRASRIKQLASGRFGVWAAYLADPMLEELEIKIGQGAKPGEGGQLPAAKVTVEIAAA
FT                   RGGTPGVELVSPPPHHDTYSIEDLAQLIHDCKAARVRVIVKLVSSEGIGTIAVGVAKAG
FT                   ADVINVAGNTGGTGAASVTSLKYTGRVAEIGIAEVHQALCANGLRDKVLLRCSGAQQTG
FT                   SDVVKSALLGGDSFEFGTTALMMLKCVMAKNCNVKCPAGLTTNAEAFDGDPRQLAQYFL
FT                   NVAHEVREILARMGLRSLREARGRADLLHLMDHPLEVGKLDLRAMLTVVPELKIAKPVY
FT                   LEKDFELDDRWVEELSQQLVDQGKTSLQLGKDVVLNNRNKSVGGQLAIDIERMLNHTLT
FT                   AAQIQAMPAVLRDDRGRRYLAPATVEITTTGSAGQSFGAFCNDGMLMKHRGTCNDGVGK
FT                   GQCGGELVVLSPGGGAQDSDGNVLIGNFALFGATGGRLFVQGQAGDRFAVRNSGATAVV
FT                   EGVGDFCCEYMTNGAVLNLGTFGKGFGNGMSGGFAYQYDPYGSLASHAAGDSVLFGSIA
FT                   DPDELAQIHKQAVLTMLNWHLEATQSPRAAWLLEHWETECQHFVYVMPRSLLLYQDGGE
FT                   ILKAKSRKDLLEELSTALAGHQVAKFKAAWREGKTIADGAVPAYGATDTQEMFVLLNNY
FT                   TVLSFAQQLALSKLPKGTPVEDAAVEKAVRNLLMTEDFSLVSKLQRHARAAIESYSDSE
FT                   LASLIGSKRMSDYKAALTQRNIRSMDSLATYGWIMYQDACNRDILGRLPDFEELFARAA
FT                   LPEIAAAVGKLA"
     gtgcgtaaaa cccaatcgcg caggctgtca ggcgcggaaa tgaaagaatt tgcgctggga        60
     agtgtgcagt tgaactcagt gcctgaaaca atgcaggtaa tgtctaaagc agttttaagg       120
     agaccctcaa tgtccagtaa aaaacctgat tcctatggct tatatgaccc agcagcagga       180
     agtgacagct gtggtgtagg tttcattacc cgtaaggacg gcgagcagac tcatgaaatt       240
     ctgcgcatgg cgcacagcgc actctgtacg gttccgcacc gtggcggtat gtccgccgaa       300
     ggcgtgggcg atggcgccgg ggttaacgtc gatctttccc tgcatttttt ccgtaaaatt       360
     accggtcagg cgcttgaggc cggacgcttt ggtgtaggta acttcttcgt gccgaaagac       420
     acggaactgc gcgccaatgc cgaacgttta gtcgaagaga cgctaaatcg ctttaatctg       480
     ccggttatcc tgaagcgtga aatgccgctg gataacagcg tcacgcgccc ggctgccatg       540
     cagtttcagc ttcccattgt gcagtggatt tttgccgcac ctcaggacat cagcaatcag       600
     atcgatttcg aaaaactgat ttatcgcgcc ctgctgacga tcgaggcaca agcctttacc       660
     caaaccgaat ttggcgggtt atatccactg tcattgtcgt cgcgcaccca ggtctttaaa       720
     gcgcgcctga attcgaatga agtgatccct tacttcaaag atctgaccga tcccgatcat       780
     cacgtacgcg gactgttttt ccatactcgc ttctcaacga ataccgatcc gcacaccacc       840
     atggcacagc ctttccggtt gatggcccac aacggtgagc tgaataccga tcgtaaaaac       900
     cgcatcgccg aatctgcgtt ggcttccgcc cgtggcaaaa ctattgtgcg tccgaaaggc       960
     cagtcagaca gttcgcgact ggatcagagc attcacagcc gcctgatgga agacgatctg      1020
     gacctgatca ccgcggtggt gtcgatgatg ccgcctgcct gggaaaacga taccgcgctc      1080
     tcccctgccg tgcgtgacat gctggaatac ttttcgcttt atgaagagaa aaacgatggc      1140
     ccggccgcct taatttttgg taacggcgag gtaatcggtg cgcgtcttga tcgcctgggg      1200
     ctgcgcccgc tgcgttcaat cgaaacggcg gaatacatcg gtgccatgtc cgaagcggga      1260
     caaattgcct ttccccctga aagcgtgctg cgccgtggcc gtattgaagc cggcggcatg      1320
     ctgtattttg accatcgcga aaagcgcagt tacaccacgc accaggcgct ggagaagctg      1380
     gctgctgaaa aagactatgc ggcattgctc ggcaagtcgc gtgtcgattt acgagagctg      1440
     ccggttattc ctgctgaaca acagggttct cccctgcgct atcgcggcga tctgaaaacc      1500
     tatcagcgct tcgtggcgta ctactacaac caggaaagct ttaagttcat gatggatccg      1560
     atgctgaaca ccggcgccga gaaaatctct gcgatgggtt acggcaatgc gattaacggc      1620
     ctctccgatc atgaaggcgg catggcgcac tacttctcgc agcgctttgc ccaggtgacc      1680
     aatccaccac tggactccat tcgcgaagcg gatggcatga cgctgcgcgt ggcgctgggc      1740
     gctaaaccgc atctgggccg cagtaaaggt cggcagatca ttgtgccaac cccgattctg      1800
     acccatctgg acatgctgca gctgcgcgag cagaacgtgg ccccttacgc tcgcttcgaa      1860
     atgctttacg agccggtcac cggcaaagat ctgctgagcc gcacagcgaa cgccagcgcg      1920
     ctggaaaaag cgattgacga tctggcacag caggtggtgg attttgcccg ctcagagggc      1980
     ggcattgccg tactgaccga tcgccatatc tcttctaccc aggccgcatt gcccatgctg      2040
     ctggtcattt ctgccgttaa ccagcgtctg gtacaggaag gtttacgcct ggatgtgtcg      2100
     ctggtggtgg agagcggaca gatcatctct tctcaccata ttgcggctac gctgggcttt      2160
     ggcgcgtcag ccgtttatcc gctcggtgtg caaatgcgtg ctgaagaaaa atttggtgaa      2220
     ggcgaagaag gcaacaaagc ctttaaacgc tacgctaaag cggccgaaaa agccctgatg      2280
     aaaaccatgg gtaaagtggg gctgtgtacc gttgagagct acagcagcgg cgagttcttc      2340
     gagcctaact tcctgaatac cgatgacccg gtactgagaa agtattttcc aaacattaaa      2400
     acgcctgtgg gcggcgcggg cttcgcaacc atcgctcaga tggcggtgga ctggcatcag      2460
     agcgcactga aaattcaggg cgagtccgaa gtgccgctgt taggcctgtt taaagaacgt      2520
     gcagagggcg caggccactc ttacggcacc attgccgtac gcacctttat tgatatgacg      2580
     gaagagccga ttcgcttcgc ggacaaagcg cgtgaagagg ataactttat tcgtctgatg      2640
     acgctggccc gtctggacaa tgcctttggc atcaagcctg agacgtttaa agacagcagc      2700
     tttgagcgca tcccggatga ggtgatgaat gattttgcca ttacggccga ttatcgtcag      2760
     ttctccagcc tgatgtacga agagcgcaaa cgccgcccag ccgcgctgcg cgatattctg      2820
     gccttcccgg cagatcttac ccacatcgac agtgaggccg aattccggcg taagctgggt      2880
     cgctactcgc tgactaacaa tggttttgcc acccgcggcc tggtctgtga cgccattgag      2940
     ggcagccaga atgcctttat gctgcgtctg accgatgcca ttgccggact gaaaccagaa      3000
     agtgaacgcc tgctcaacct gtcacgtgcg ctgaaagccc gttttaacga cgagattgaa      3060
     accgcagaag tggttgctgg cggcctgaaa gtcaccgcca gcggcaaagc ggcggactac      3120
     ctgtcacgca ttttcacggc gctgccgtcg ctgccgttga gcgatattca gcccgcgagc      3180
     gaaattaccc gcactttcgc gtctggcgcg atgagtcacg gtgcgctggt cgcaccggcg      3240
     catgaagccg ttgcgcatgg caccaacatg gtcggaggca tgagtaactg tggagaaggc      3300
     ggtgagcact actcccgtca cggcaccatt cgcgcttcac gtatcaaaca gctggcgtca      3360
     ggccgctttg gcgtctgggc ggcctacctg gccgatccga tgctggaaga gcttgagatc      3420
     aaaatcggcc agggcgccaa gcccggtgaa ggcggtcagc ttccggcggc aaaagttacc      3480
     gtagagatcg ccgccgcgcg cggcggcacg ccaggcgttg agctggtttc tccgccgccg      3540
     caccacgata cctactctat cgaagatctg gcgcagctga ttcacgactg taaagcggcc      3600
     cgcgtgcgcg tcattgtgaa gctggtgtca tctgaaggta ttggcaccat cgccgtgggc      3660
     gtggcgaaag ccggtgctga cgtgattaac gttgccggta acacgggtgg tacaggcgcc      3720
     gcctcggtga ccagcctgaa atataccggt cgcgttgccg aaatcggtat cgccgaagtt      3780
     caccaggccc tgtgtgcaaa cggcctgcgc gacaaagttc tgctgcgttg ctcaggcgca      3840
     cagcaaaccg gcagcgacgt ggtgaaatcc gcactgctgg gcggcgacag ctttgagttt      3900
     ggtaccaccg cgctgatgat gctgaagtgc gtgatggcga agaactgtaa cgttaaatgc      3960
     ccggcgggat taaccactaa cgccgaagcc tttgatggcg atccacgcca gctggcacag      4020
     tacttcctga acgtagcgca tgaagtgcgt gagattctgg cgcgtatggg cctgcgttcc      4080
     ctgcgtgaag cccgtggccg cgccgatctg cttcatctta tggatcaccc gttggaagtc      4140
     ggtaagctgg acctgcgtgc catgctgacc gtggtgcccg agctgaagat tgctaagcca      4200
     gtttatctgg agaaagattt tgaactggat gaccgctggg ttgaagaact gagccagcaa      4260
     ctggtcgatc agggtaaaac ctctctgcaa ctgggtaagg atgttgtact caacaaccgc      4320
     aataaaagcg tgggcggcca gttagctatc gatattgagc gcatgctgaa tcacaccctg      4380
     acggctgcac agattcaggc aatgccggcc gtgctacgtg acgatcgcgg tcgtcgctat      4440
     ctggcacctg ccaccgtaga aatcaccacg accggctctg ccggtcagtc cttcggggcc      4500
     ttctgcaatg acggcatgct gatgaaacat cgtggaacct gtaacgatgg cgtcggcaaa      4560
     ggtcagtgcg gcggcgaact ggtcgtgctc tcaccgggcg gcggcgcgca ggacagcgat      4620
     ggcaacgttc tgatcggtaa cttcgctctg tttggcgcca ccggcggccg tctgttcgtt      4680
     cagggccagg ccggcgatcg cttcgcggtg cgtaactccg gtgccactgc ggtggtggaa      4740
     ggcgtcggtg acttctgctg cgaatacatg accaacggcg cagtgttaaa cctgggcacc      4800
     tttggtaaag gcttcggtaa cggcatgagc ggcggctttg cttatcagta cgatccctat      4860
     ggttcactgg cgagccatgc ggcgggcgac tccgttctgt ttggctcaat cgctgacccg      4920
     gatgagctgg cacagattca taagcaggcg gttctcacca tgctgaactg gcacctggag      4980
     gccacgcagt ctccgcgtgc cgcctggctg ctggagcact gggaaaccga atgtcagcac      5040
     tttgtctacg ttatgccgcg ttccctgctg ctttaccagg atggcggtga aattctgaag      5100
     gccaagtccc gcaaggatct gctggaagag ctgtcaacgg cgctggcagg ccatcaggtt      5160
     gccaagttta aagccgcctg gcgcgaaggc aagaccattg ccgacggcgc ggttccggct      5220
     tatggcgcga cagatacgca ggaaatgttt gttttactga ataactacac cgtattgagc      5280
     tttgcccagc agttggcact cagcaagctg cctaaaggca cgccggttga agacgccgcc      5340
     gtggagaaag ccgtgcggaa tctgctgatg accgaagact tttcactggt gagtaagctg      5400
     caacgccatg cgcgagcagc gattgaaagc tatagcgaca gcgagttggc cagcctgatc      5460
     ggttcaaaac gcatgtccga ttacaaagcg gcactgacgc aacgtaatat ccgctcaatg      5520
     gacagcctgg ccacttacgg ctggatcatg tatcaggatg cctgcaaccg tgacattctc      5580
     ggtcgcctgc ctgattttga agagttgttt gcgcgtgcgg cgttacctga aattgcagcg      5640
     gccgtgggta aactggcctg a                                                5661
//

If you have problems or comments...

PBIL Back to PBIL home page