(data stored in SCRATCH zone)

EMBL: CP001875.IUCB

CP001875.IUCB        Location/Qualifiers
FT   CDS_pept        421172..422119
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="iucB"
FT                   /locus_tag="PANA_0350"
FT                   /product="IucB"
FT                   /note="Aerobactin siderophore biosynthesis protein IucB;
FT                   Similar to Pectobacterium wasabiae WPP163, Siderophore
FT                   biosynthesis protein, conserved region (NCBI:
FT                   YP_003258373.1); COG: Inorganic ion transport and
FT                   metabolism; Subcellular localization as predicted by Psort
FT                   2.0: Unknown"
FT                   /db_xref="EnsemblGenomes-Gn:PANA_0350"
FT                   /db_xref="EnsemblGenomes-Tr:ADD75517"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="InterPro:IPR019432"
FT                   /db_xref="UniProtKB/TrEMBL:D4GHY7"
FT                   /protein_id="ADD75517.1"
FT                   /translation="MSQATIVHSGHGLRCEKSGKTLNLGWGQDNSAVLHFAGPLPEGWL
FT                   RDALDQMFIAAPQLSAVVLPFAEWREEPQALALFAALKSDIVHRETFWQLPLWLSAPRQ
FT                   QASGEMVFDAEREIYFPQRPARPDGEVYRRYDPRVRRTLSFRVADPARDAEAFTRWMND
FT                   PRVDYFWEQSGSLATQTAYLERQLGSSYAFPLIGCFDDKPFSYFEIYWAAEDRIGRHYS
FT                   WQPYDRGLHLLVGEPQWRGPHFVQSWLRGISHYLLLDNPQTQRLVLEPRADNQRLFRHL
FT                   EPAGYTTVKEFDFPHKRSRLVMTQRARFFSEVGL"
     atgtctcagg caacgattgt tcacagcggc cacggcctgc gttgcgaaaa gtcaggaaaa        60
     accctgaatc tgggttgggg acaggacaac agtgcggtgc tgcattttgc cggtccactg       120
     cccgaaggct ggctgcgtga tgcgctggat cagatgttta tcgctgcccc gcagctttct       180
     gccgtggtgc tgcccttcgc agagtggcgt gaagagcctc aggcgctggc gctgtttgcg       240
     gcactgaaaa gcgatatcgt ccaccgcgag acgttctggc aactgccgct gtggttgtct       300
     gcgcctcgtc agcaggcctc cggcgagatg gtatttgatg ccgaacgtga gatctatttt       360
     ccccagcgcc cagcgcgacc tgatggcgaa gtgtatcgcc gttacgatcc gcgcgtacgg       420
     cgaacgctga gcttccgcgt ggccgatcct gcccgggatg ccgaagcgtt tacccgctgg       480
     atgaacgatc cgcgcgtgga ttacttctgg gagcagagcg gatcgctggc cactcagacc       540
     gcctatcttg aacgccagct cggcagcagc tatgcctttc cgctgattgg ctgttttgat       600
     gacaagccct tcagctactt tgaaatttac tgggcggcgg aagatcgtat cggacggcac       660
     tacagctggc agccgtacga tcgcggtttg catctgctgg tgggggagcc gcagtggcgc       720
     gggccgcact ttgtgcagag ctggctgcgc ggcatcagcc actatctgct gctggataat       780
     ccgcaaactc agcgcctggt gctggaacca cgggcggata atcagcgcct gtttcgtcac       840
     cttgaacccg cgggctatac caccgtgaaa gagttcgact ttccgcacaa gcgctctcgc       900
     ctggtgatga cccagcgcgc ccgtttcttc agcgaggtgg gcctgtga                    948
//

If you have problems or comments...

PBIL Back to PBIL home page