(data stored in SCRATCH zone)

EMBL: CP001875.MIOC

CP001875.MIOC        Location/Qualifiers
FT   CDS_pept        18195..18635
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mioC"
FT                   /locus_tag="PANA_0017"
FT                   /product="MioC"
FT                   /note="Protein MioC; Similar to Pantoea sp. At-9b,
FT                   flavodoxin/nitric oxide synthase (NCBI: ZP_05729605.1);
FT                   COG: Energy production and conversion; Subcellular
FT                   localization as predicted by Psort 2.0: Unknown"
FT                   /db_xref="EnsemblGenomes-Gn:PANA_0017"
FT                   /db_xref="EnsemblGenomes-Tr:ADD75184"
FT                   /db_xref="GOA:D4GFS0"
FT                   /db_xref="InterPro:IPR001094"
FT                   /db_xref="InterPro:IPR008254"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="UniProtKB/TrEMBL:D4GFS0"
FT                   /protein_id="ADD75184.1"
FT                   /translation="MADITLISGSTLGSAEYVAEHLEEKLQEAGFSTQMLHGPELHDVP
FT                   LQGIWLVVSSTHGAGELPDNLQPFYDAIEESRPDLSAVRFGAVGIGNHEYDLFCGAIRN
FT                   LDALLITCGAQRIGERLEIDILQHEIPEDPAEEWVMTWKDAI"
     atggccgaca ttacgttaat cagtggcagc accttaggca gcgccgaata tgttgctgaa        60
     catctcgaag aaaaactgca ggaagcgggc ttctcaacgc agatgctaca tggtcctgag       120
     cttcatgatg tgcccctgca gggaatctgg ctggtcgtga gttctaccca cggagccgga       180
     gagttgcctg ataatctgca acctttttat gacgccattg aggaaagccg tcccgatctg       240
     tcagccgtgc gttttggcgc agtcggcatc ggcaaccatg aatacgatct gttttgtggt       300
     gcgatacgca atcttgacgc tctgttaatt acctgtggcg cacagcgcat cggcgaaaga       360
     ctggaaattg atattctgca acatgagatc cccgaagatc cggctgaaga gtgggtgatg       420
     acctggaaag acgcgatctg a                                                 441
//

If you have problems or comments...

PBIL Back to PBIL home page