(data stored in SCRATCH zone)

EMBL: CP001875.PE278

CP001875.PE278       Location/Qualifiers
FT   CDS_pept        338211..339467
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PANA_0278"
FT                   /product="Hypothetical Protein"
FT                   /note="Polysaccharide Biosynthesis Protein; Similar to
FT                   Pantoea sp. At-9b, polysaccharide biosynthesis protein
FT                   (NCBI: ZP_05731745.1); COG: Cell wall/membrane/envelope
FT                   biogenesis; Subcellular localization as predicted by Psort
FT                   2.0: Inner Membrane"
FT                   /db_xref="EnsemblGenomes-Gn:PANA_0278"
FT                   /db_xref="EnsemblGenomes-Tr:ADD75445"
FT                   /db_xref="GOA:D4GHD0"
FT                   /db_xref="InterPro:IPR002797"
FT                   /db_xref="UniProtKB/TrEMBL:D4GHD0"
FT                   /protein_id="ADD75445.1"
FT                   /translation="MKLSVMSNAAWMMSEKIISVFGVIFVTSYVAKSFGPTLFGQMAFS
FT                   TSLFAMVQTIALFGTETILFKRVSKNAAKGLRLMRIARTLRMGLLLLTSGPVLIWVWYN
FT                   MQENFLAFALASFVASVFVTQDTFSVYNNARLASKLNTVANAIGMLMSFALSFIIAWLR
FT                   LNPLWLTLSVITVTLVPYAIKRYTFYQAHQDQLPPRETRTLYLRYLMYAGLPLAISSIF
FT                   ISVQVKAAQMFLAGIASAQELGLFAAANTIAASWIFIPVALITSCFSEIFRARGEEAIR
FT                   LTARLNGYVMAVSLLMLLIVALFGEQIIIALYGPAFTQSGNLITLLSIATSFSALGTVA
FT                   YRYMVKEGGFDYLLKKIICLVIISMPLSWWLIQGYGITGAAWSVFLSELLSLTVMNYFF
FT                   KHGVIQKIQVSSLNYKTYK"
     atgaaattga gcgtaatgtc taatgccgcc tggatgatgt ctgaaaagat tatctccgtc        60
     tttggcgtca ttttcgtgac gtcatatgtg gcaaaatcct tcggtccgac cctatttggt       120
     cagatggcat tttcaacgtc attatttgct atggtgcaaa ccatagccct ctttggcact       180
     gaaacaattt tgtttaaacg tgtcagcaaa aatgcggcca aaggtttacg tttaatgcgc       240
     atcgcacgca cgttgcgcat gggtttatta cttctcacct cagggccagt attaatttgg       300
     gtttggtaca acatgcagga gaacttcctg gcatttgcac tggcctcttt tgttgcgtct       360
     gtttttgtca cacaggacac ctttagcgtt tacaacaatg cacgattggc ttcaaagctg       420
     aataccgtgg cgaatgcgat tggcatgctg atgagttttg ccctgagctt tatcattgcc       480
     tggctgcgtc tcaatccatt gtggctaacg ctttcggtta tcacggtcac gctggtgcct       540
     tacgccatca aacgttacac cttttatcag gcacatcagg accagcttcc gccgcgcgag       600
     acgcgaacgc tgtatttgcg ttacctgatg tatgccggat tgcctctggc gatttccagc       660
     atttttatct ctgtccaggt aaaagctgcg cagatgtttt tggctggcat cgcatcggcc       720
     caggagcttg gcttgtttgc cgcagccaat accatcgccg cctcgtggat ttttattccc       780
     gtcgcactca tcacctcgtg ctttagcgaa atttttcgcg cgcgcggtga ggaagcgatc       840
     aggctgacgg cgcggctcaa tggctacgtg atggccgtgt ctttgctgat gttgctgatc       900
     gtcgcactgt tcggtgaaca gataatcatc gcgctgtatg gcccagcgtt tacccagtca       960
     ggcaatctca tcaccctgct gtcgatagcg accagctttt cggcgctggg caccgtcgcg      1020
     tatcgctaca tggtaaagga agggggcttt gattatttac tgaagaaaat catttgtctg      1080
     gtgatcatca gtatgccgct ttcctggtgg ctgattcagg gctatggcat tacaggagcc      1140
     gcatggagcg tttttctttc agagctcctg tccctgaccg tcatgaatta tttctttaaa      1200
     cacggcgtga ttcaaaaaat ccaggtttcc tcactcaact acaaaaccta caaatga         1257
//

If you have problems or comments...

PBIL Back to PBIL home page