(data stored in SCRATCH zone)

EMBL: CP001875.PE31

CP001875.PE31        Location/Qualifiers
FT   CDS_pept        complement(32833..33258)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PANA_0031"
FT                   /product="Hypothetical Protein"
FT                   /note="No significant BLAST hits found; COG: Unknown
FT                   Function; Subcellular localization as predicted by Psort
FT                   2.0: Unknown"
FT                   /db_xref="EnsemblGenomes-Gn:PANA_0031"
FT                   /db_xref="EnsemblGenomes-Tr:ADD75198"
FT                   /db_xref="UniProtKB/TrEMBL:D4GFT4"
FT                   /protein_id="ADD75198.1"
FT                   /translation="MLIFTSPLLKRTCSMKFMKKLLVGNIVVLCTLASAQAYDVPQIHS
FT                   DESFAMTDNRGTLATIDSGGAVRQASVNAEDVSKTKDNVEKLLKTQENQTDTLNQLTQK
FT                   LSKNEDTINNLQRSLDEANRKISDQQRVIEQVSSKIK"
     ttgctaattt ttacaagccc actattgaaa aggacatgtt cgatgaaatt tatgaagaag        60
     cttctggtag gcaatatcgt cgtcctctgt acgctggcca gcgcccaggc gtacgacgta       120
     ccgcagattc attcggatga atcttttgca atgacagata acagaggcac tctggccaca       180
     attgatagtg gtggcgcggt cagacaagct tctgtcaatg ctgaggatgt gagtaaaacg       240
     aaggataatg tagagaaatt attaaaaacg caagaaaacc agactgatac cctcaaccag       300
     ctcacacaaa agctcagtaa aaatgaagat acgatcaata acctgcaacg ctcactcgat       360
     gaggctaacc gtaaaatcag cgatcagcag cgcgtaattg agcaagtcag cagcaaaatc       420
     aaataa                                                                  426
//

If you have problems or comments...

PBIL Back to PBIL home page