(data stored in SCRATCH zone)

EMBL: CP001875.PE339

CP001875.PE339       Location/Qualifiers
FT   CDS_pept        complement(410702..411127)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PANA_0339"
FT                   /product="Hypothetical Protein"
FT                   /note="YeeE/YedE Family Protein; Similar to
FT                   Janthinobacterium sp. Marseille, hypothetical protein
FT                   mma_0458 (NCBI: YP_001352148.1); COG: Unknown Function;
FT                   Subcellular localization as predicted by Psort 2.0: Inner
FT                   Membrane"
FT                   /db_xref="EnsemblGenomes-Gn:PANA_0339"
FT                   /db_xref="EnsemblGenomes-Tr:ADD75506"
FT                   /db_xref="GOA:D4GHX6"
FT                   /db_xref="UniProtKB/TrEMBL:D4GHX6"
FT                   /protein_id="ADD75506.1"
FT                   /translation="MHIDLVHFTPLQSLVGGLLIGAAAGILVLLCGRIAGISGILGGLL
FT                   KRRSSDKPWRLAFIAGLVLSPLVFQLFSALPAIETEASWGRLVLAGVLVGLGVRLGSGC
FT                   TSGHGVCGLSRLSLRSLVATLVFMLTAMLTVGVMGHG"
     atgcatattg acctggttca ttttacgccg ctgcaaagcc tggtgggtgg gctgctgatt        60
     ggcgcggcgg cgggcatact ggtgctgctt tgtggccgca tagccggtat cagcggcatt       120
     ctgggcggtc tgcttaaacg ccgctcatca gacaagccct ggcggctggc ctttattgcg       180
     ggcctggtcc tgtcgccgct ggtgttccag ctgttcagcg ccctgcccgc cattgaaact       240
     gaagcgtcat ggggacgtct ggtactcgcc ggcgtgctgg tgggattggg tgttcgcctg       300
     ggctcgggct gcaccagcgg tcacggcgta tgtggattat cgcggctgtc actgcgctca       360
     ctggtggcga cgctggtctt tatgttaacc gccatgctga ccgttggcgt gatgggccac       420
     gggtga                                                                  426
//

If you have problems or comments...

PBIL Back to PBIL home page