(data stored in SCRATCH zone)

EMBL: CP001875.PE378

CP001875.PE378       Location/Qualifiers
FT   CDS_pept        450677..451468
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PANA_0378"
FT                   /product="Hypothetical Protein"
FT                   /note="Similar to Dickeya dadantii Ech586, hypothetical
FT                   protein Dd586_3218 (NCBI: YP_003334759.1); COG: General
FT                   function prediction only; Subcellular localization as
FT                   predicted by Psort 2.0: Unknown"
FT                   /db_xref="EnsemblGenomes-Gn:PANA_0378"
FT                   /db_xref="EnsemblGenomes-Tr:ADD75545"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:D4GI15"
FT                   /protein_id="ADD75545.1"
FT                   /translation="MERRMWGKTGKAIRLKLAVLLGLTLLSTQIMAEAAAIKNIVLVHG
FT                   AFTDGSSWKAVITQLQHKGYHVTAVQNPLTSLQDDVNATEHVIARQQGPVLLVGHSWGG
FT                   VVVADAANDPKVKGMVFLSALVPDSGESAADLLQRLHAPMTGMLADSHGLIWLDSADHF
FT                   AEIMAGDVPEALVRELTAVQQPIAARAFDDKVKRAAWKSKPSWYLLTTDDKALPPAVQT
FT                   RIAASIGASIERIASSHMSLVSHPEQVAALIDRAARTLTTP"
     gtggaaagac ggatgtgggg aaaaacagga aaagcgatac gtttaaaact cgccgttctg        60
     ctgggcctga cgttactcag cacgcaaatc atggcggagg cagcagccat caaaaacatt       120
     gtgttagttc acggcgcttt taccgatggc tcaagctgga aagccgtgat tacccagctt       180
     cagcataaag gctatcacgt tactgccgta cagaatccgc tgacctcgct gcaggatgat       240
     gtcaatgcca ctgagcatgt cattgcgcgt caacaggggc cggtgctgct ggtggggcat       300
     tcctggggcg gggtggtggt tgccgacgcg gcaaatgatc caaaggtcaa agggatggtg       360
     tttctctctg cgctggtgcc tgacagcggt gaatctgccg ccgatctgtt gcagcgactt       420
     catgccccga tgacagggat gttggctgac agtcatggac tgatctggct cgatagtgca       480
     gaccatttcg ctgagatcat ggccggtgac gtgcctgaag cactggtgcg tgaactgact       540
     gcggtccagc agcccatagc ggcgcgggcg tttgatgaca aggtgaaacg ggccgcatgg       600
     aaaagcaaac cctcatggta tttgctgacc acagatgaca aggcgctacc gcctgccgtc       660
     cagacgcgca ttgctgcctc catcggagcc agcattgagc gcatcgcctc cagtcatatg       720
     tctcttgttt cacatcctga acaggttgcg gctttgatag atcgcgccgc caggaccctt       780
     accactccgt ag                                                           792
//

If you have problems or comments...

PBIL Back to PBIL home page