(data stored in SCRATCH zone)

EMBL: CP001875.PE388

CP001875.PE388       Location/Qualifiers
FT   CDS_pept        complement(462477..462761)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PANA_0388"
FT                   /product="Hypothetical Protein"
FT                   /note="Similar to Dickeya dadantii Ech586, transposase
FT                   IS3/IS911 family protein (NCBI: YP_003333843.1); COG:
FT                   General function prediction only; Subcellular localization
FT                   as predicted by Psort 2.0: Unknown"
FT                   /db_xref="EnsemblGenomes-Gn:PANA_0388"
FT                   /db_xref="EnsemblGenomes-Tr:ADD75555"
FT                   /db_xref="UniProtKB/TrEMBL:D4GI25"
FT                   /protein_id="ADD75555.1"
FT                   /translation="MLLFRVSTGRDDLPDGLLYRSRTLTEFGKITERWLTAFNSPRSYA
FT                   CLNKLTLEKQRLMLTIRKSQNQVKLKQQHAPPCTRRLVVNNENRRQFES"
     gtgctcttat tccgcgtttc aactggacgt gacgacctgc cagacgggtt gttatatcgc        60
     tcaaggacac tgactgaatt tgggaaaatc acagagcgtt ggctgacggc attcaacagc       120
     ccgcgctctt atgcatgcct taacaaactg acgctggaaa aacagcgcct gatgctgacg       180
     atccggaaat cgcaaaacca ggtaaagtta aaacaacaac atgccccgcc ctgcaccaga       240
     aggctggtag tgaataatga aaacaggcga cagtttgaat cttaa                       285
//

If you have problems or comments...

PBIL Back to PBIL home page