(data stored in SCRATCH zone)

EMBL: CP001875.PE390

CP001875.PE390       Location/Qualifiers
FT   CDS_pept        463070..463204
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PANA_0390"
FT                   /product="Hypothetical Protein"
FT                   /note="Similar to Salmonella enterica subsp. enterica
FT                   serovar Hadar str. RI_05P066, ISEhe3 OrfA (NCBI:
FT                   ZP_02684437.1); COG: General function prediction only;
FT                   Subcellular localization as predicted by Psort 2.0:
FT                   Unknown"
FT                   /db_xref="EnsemblGenomes-Gn:PANA_0390"
FT                   /db_xref="EnsemblGenomes-Tr:ADD75557"
FT                   /db_xref="GOA:D4GI27"
FT                   /db_xref="InterPro:IPR002514"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:D4GI27"
FT                   /protein_id="ADD75557.1"
FT                   /translation="MSMSGKRYPEAFKIEAVKQVVDRGHSVSSLALRLDIPTHRFTQG"
     gtgtccatga gcggtaagcg ttatcccgaa gcgtttaaaa tcgaagcagt gaaacaggtc        60
     gttgatcgcg gccattctgt ttccagtctc gcactacgcc tcgatatccc cacccaccgc       120
     ttcacgcagg gataa                                                        135
//

If you have problems or comments...

PBIL Back to PBIL home page