(data stored in SCRATCH zone)

EMBL: CP001875.PE47

CP001875.PE47        Location/Qualifiers
FT   CDS_pept        51354..52838
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rbsA"
FT                   /locus_tag="PANA_0047"
FT                   /product="RbsA"
FT                   /note="Ribose transport ATP-binding protein RbsA; Similar
FT                   to Rhizobium leguminosarum bv. viciae 3841, putative
FT                   ATP-binding component of ABC transporter (NCBI:
FT                   YP_770981.1); COG: Carbohydrate transport and metabolism;
FT                   Subcellular localization as predicted by Psort 2.0: Inner
FT                   Membrane"
FT                   /db_xref="EnsemblGenomes-Gn:PANA_0047"
FT                   /db_xref="EnsemblGenomes-Tr:ADD75214"
FT                   /db_xref="GOA:D4GFV0"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4GFV0"
FT                   /protein_id="ADD75214.1"
FT                   /translation="MPVFLQLDGISKIFGGVHALSDVSLTLEEGEVHCLCGQNGCGKST
FT                   LIKVMSGVHQPEPGGRITISGNEVSPLTPVESTRLGVQVIYQDLSLFPNLTVAENIAIG
FT                   QHTGRFKRVNWKKIYEIAAEAVTRIGVSLDLNDKVADISIAQRQLVAICRAMAANARLV
FT                   IMDEPTSSLTRHEVDALLKLTLQLKQRGITIVFVSHRLDEVLEIADRVTVMRDGVKLGT
FT                   FDAREMSDRKLATLMTGKEFHYESVAKDRPQTETVLEVSNLSRKGEYRDISFDIRRGEI
FT                   LGLTGLLGSGRTELALSLFGLTRPHQGEIKLHGHAVQMRSNRDAIEHGIAYLSEDRLGL
FT                   GLVLEQSISANITLSVVEKLVNKAGLIRDDLYEQTVNDAIASLSIKAGNPDNKVKTLSG
FT                   GNQQRVVLAKWLATQPKLLILDSPTVGVDIHAKDGIYAIVRKLAASGIAIIMISDEIPE
FT                   IYYHSDRVLVMRGGRLNGEYFPGRCSEEELKEAVNA"
     atgcctgtat ttttacaact cgatggcata tcgaaaatat tcggcggcgt gcatgcactt        60
     tcagatgtca gcctcacgct tgaagagggc gaggtacatt gtctgtgcgg acagaatggc       120
     tgcggtaagt cgacgttgat caaagtgatg tctggcgtac atcagcccga gccgggtggc       180
     cgtattacga ttagcggaaa tgaggtttcg ccgctaacgc cagtagaaag tacccgtctg       240
     ggcgtgcagg tgatctatca ggacctgtct ctgttcccta atttaaccgt ggcggagaac       300
     attgccatcg gtcagcatac cggccgcttt aaacgggtta actggaaaaa gatttatgag       360
     atagcggccg aagcggttac gcgcattggc gtttcgctcg acctgaatga caaagtggct       420
     gatatctcta ttgctcagcg tcagctggtg gcaatttgcc gggcgatggc ggcgaatgcc       480
     cggttggtga ttatggatga acccacctcc tccctgacgc gccatgaagt ggacgcctta       540
     ctgaagctca ccctgcagct taaacagcgc ggcatcacga ttgtttttgt cagccatcgt       600
     ctggatgaag tgctggaaat tgccgatcgc gtgaccgtga tgcgcgatgg cgtgaagctg       660
     ggcacctttg atgcccgcga gatgtcagac cgtaaactgg ccacgctgat gacgggtaaa       720
     gagttccatt atgaatccgt tgccaaagac agaccgcaaa ccgaaacggt gctcgaagtc       780
     agcaacttgt cccgtaaagg tgagtatcgg gatatttcgt ttgatatccg gcgtggcgaa       840
     attctcggtc tcaccggcct gttggggtcg ggacgcaccg aattagcgct gagcctgttt       900
     ggtctgacgc gcccacatca gggcgaaata aaactccacg gtcatgccgt acaaatgcga       960
     tctaaccgcg atgctattga acacggcatt gcctatctgt cagaagatcg tctgggactg      1020
     ggcctggtac tggagcagtc cattagcgct aacattacgc tttctgtagt ggagaagctg      1080
     gtgaacaaag ccggactcat tcgtgacgac ctgtatgagc aaacggtcaa cgacgcgatt      1140
     gcctccctgt ctattaaagc cggtaatccc gacaacaaag tcaaaaccct gtcaggcggc      1200
     aaccagcagc gggtggtgct ggcaaaatgg ctggcgacgc aacccaaact gctgatcctg      1260
     gacagcccca ccgtgggcgt cgatattcat gccaaagacg gtatttacgc catcgtgcgg      1320
     aaactggccg ccagcggtat cgccatcatt atgatttccg atgagattcc cgagatttat      1380
     tatcacagcg atcgggtgtt agtgatgcgc ggcggcaggc ttaatgggga atacttccct      1440
     ggccgctgca gcgaagaaga attaaaggag gcagtaaatg cgtga                      1485
//

If you have problems or comments...

PBIL Back to PBIL home page