(data stored in SCRATCH zone)

EMBL: CP001875.PE495

CP001875.PE495       Location/Qualifiers
FT   CDS_pept        578767..579192
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PANA_0495"
FT                   /product="Hypothetical Protein"
FT                   /note="Similar to Yersinia pestis KIM, hypothetical protein
FT                   y0744 (NCBI: NP_668081.1); COG: Unknown Function;
FT                   Subcellular localization as predicted by Psort 2.0:
FT                   Unknown"
FT                   /db_xref="EnsemblGenomes-Gn:PANA_0495"
FT                   /db_xref="EnsemblGenomes-Tr:ADD75662"
FT                   /db_xref="UniProtKB/TrEMBL:D4GIR7"
FT                   /protein_id="ADD75662.1"
FT                   /translation="MSYPFLLCRLRLWRRCRIQLEANAAIRFVAIARQLFESVFVRNEV
FT                   YHFMESSSKICELRQQADQQVAWRIAPTLRPCQLNRCAVARTFPGEIVRHKGVGGALPQ
FT                   RLIKPNGLLLIFTGDEHPLTGPPACFRQIAHQRFNGA"
     atgtcttatc catttctgct atgtcgtttg cggctgtggc ggcgttgccg tattcaattg        60
     gaagccaacg ctgcgatacg ctttgtagcg atcgcgcgcc agctgtttga gagcgtcttc       120
     gtaaggaacg aagtctatca cttcatggaa agcagtagca aaatctgcga actgcggcag       180
     caggctgatc agcaggtcgc gtggcgaatt gccccgacgc tgcggccatg ccagctcaac       240
     cggtgcgccg tagcgcggac cttccccggc gagattgtgc ggcacaaagg cgttggcggg       300
     gcgctgccac agcgcctcat caagccgaat ggcttgctgc tcatcttcac aggcgatgag       360
     cacccgctta ccggcccgcc agcgtgtttc cgccagatcg cacaccagcg cttcaacggc       420
     gcttaa                                                                  426
//

If you have problems or comments...

PBIL Back to PBIL home page