(data stored in SCRATCH zone)

EMBL: CP001875.PE50

CP001875.PE50        Location/Qualifiers
FT   CDS_pept        55822..56331
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PANA_0050"
FT                   /product="Hypothetical Protein"
FT                   /note="OsmC-Like Protein; Similar to Pantoea sp. At-9b,
FT                   OsmC family protein (NCBI: ZP_05726879.1); COG:
FT                   Posttranslational modification, protein turnover,
FT                   chaperones; Subcellular localization as predicted by Psort
FT                   2.0: Unknown"
FT                   /db_xref="EnsemblGenomes-Gn:PANA_0050"
FT                   /db_xref="EnsemblGenomes-Tr:ADD75217"
FT                   /db_xref="InterPro:IPR003718"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR036102"
FT                   /db_xref="UniProtKB/TrEMBL:D4GFV3"
FT                   /protein_id="ADD75217.1"
FT                   /translation="MPINANSDNHFSQEPRMATRENHYQVNVRWTGNRGAGTQSYTAYD
FT                   RNGELSGEGKATVALSADPAFRGDAARWNPEELLLASVSACHKLWYLHLCADAGIIIDA
FT                   YEDSVEGTMVEGDRGHFTRITLKPRVALRNKDDVARAEALHHHAHEACFIANSLNFPVS
FT                   FEPMFV"
     ttgcccataa acgcaaatag cgataaccac ttttcacagg agcctcgaat ggcaacacgg        60
     gagaatcatt atcaggtcaa cgtgcgctgg acgggtaatc gcggcgccgg gacgcagtct       120
     tacacggcct atgaccgaaa cggcgaactg tccggtgaag gtaaagccac ggtcgcactt       180
     agtgccgatc cggcatttcg tggtgatgcc gcgcgctgga atccagagga gctcttgctg       240
     gcgtcagtat cggcctgcca taagctgtgg tatctgcatc tttgcgccga tgccggcatt       300
     attattgacg cttatgagga ttcagttgaa ggcaccatgg tcgaagggga tcgtggccat       360
     tttacccgca ttacgctaaa acccagagtg gcgctgcgta ataaagatga tgtagcccga       420
     gccgaagcac tgcatcatca cgcccacgaa gcctgtttta tcgcaaattc actgaatttt       480
     ccggtgagtt ttgaaccgat gtttgtttaa                                        510
//

If you have problems or comments...

PBIL Back to PBIL home page