(data stored in SCRATCH zone)

EMBL: CP001875.PE509

CP001875.PE509       Location/Qualifiers
FT   CDS_pept        592217..593215
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rbsB"
FT                   /locus_tag="PANA_0509"
FT                   /product="RbsB"
FT                   /note="D-ribose-binding periplasmic protein precursor;
FT                   Similar to Klebsiella pneumoniae NTUH-K2044, putative ABC
FT                   transport system nucleotide binding/ATPase component (NCBI:
FT                   YP_002919499.1); COG: Carbohydrate transport and
FT                   metabolism; Subcellular localization as predicted by Psort
FT                   2.0: Periplasmic"
FT                   /db_xref="EnsemblGenomes-Gn:PANA_0509"
FT                   /db_xref="EnsemblGenomes-Tr:ADD75676"
FT                   /db_xref="InterPro:IPR025997"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:D4GIT1"
FT                   /protein_id="ADD75676.1"
FT                   /translation="MRRSTGYRTFPTRNFKMMAFNTRKLRSVALATGLLAAGSFFTLAH
FT                   AAPTYALVQINQQALFFNQMNQGAQEAAKASGKNLVIFNANDNPVSQNDAIENYIQQGV
FT                   KGIMVDAIDVNGIMPAIKEAAAAKIPVIAIDAVLPAGPQAAQVGVDNLEGGKIIGKYFV
FT                   DYVAKNMGGKARLGIVGALNSAVQNQRQKGFEDTIKSNPGITVADVVDGQNVQDTAMTA
FT                   AENLITGNPDLTAIYATGEPALLGAIAAVENQGRQKDIKVFGWDLTSKAITGIDNGYVT
FT                   AVLQQDPKKMGEEAVKALNAVTSGKTVSKTILVPATVVTKANVDSYRAMFK"
     atgcggagat cgactggtta tcgcacattc ccgacgagga attttaagat gatggcattt        60
     aacaccagaa aactgcgttc tgttgcgctg gcaacgggct tactggcagc gggttcgttt       120
     tttactttgg ctcatgcagc accgacttat gcgctggtac agatcaacca gcaggccctg       180
     ttctttaatc agatgaatca gggcgcacag gaagcagcga aagccagcgg taaaaattta       240
     gtgatcttca acgccaacga taatcccgta tcgcaaaacg acgcgatcga aaattatatt       300
     cagcagggcg tgaagggcat tatggtggac gcgattgacg tcaacggcat tatgcctgcg       360
     attaaagaag cagccgccgc taaaataccg gtgattgcga ttgatgcggt attaccggcg       420
     ggcccacagg cggcgcaggt gggcgtggat aatctggaag gcggtaagat tatcggcaaa       480
     tattttgtcg attacgtggc gaaaaatatg ggcggcaaag cgcggctggg cattgtgggc       540
     gcgctgaact cagccgtgca gaaccagcgt cagaaaggct ttgaagacac cattaagagc       600
     aatcctggca ttaccgtcgc ggacgtggtg gatggccaga acgtgcagga caccgcgatg       660
     acggcagcag agaacctgat caccggcaac ccggacctga cggccatcta tgccactggt       720
     gaaccggcgt tactgggcgc gattgcggcc gtagagaacc aggggcggca gaaagacatc       780
     aaggtgttcg gctgggatct gacgtcaaaa gcgatcaccg gtatcgataa cggttatgtc       840
     accgccgtcc tgcagcagga cccgaaaaaa atgggtgaag aggcggtcaa agctctgaac       900
     gcggtgacgt ccggcaaaac cgtatcgaaa actattctgg taccggcgac ggtcgtcacc       960
     aaagccaacg tggacagcta ccgcgcgatg tttaagtaa                              999
//

If you have problems or comments...

PBIL Back to PBIL home page