(data stored in SCRATCH zone)

EMBL: CP001875.PE519

CP001875.PE519       Location/Qualifiers
FT   CDS_pept        603256..604218
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PANA_0519"
FT                   /product="Hypothetical Protein"
FT                   /note="Similar to Yersinia bercovieri ATCC 43970,
FT                   hypothetical protein yberc0001_9280 (NCBI: ZP_04629028.1);
FT                   COG: Unknown Function; Subcellular localization as
FT                   predicted by Psort 2.0: Unknown"
FT                   /db_xref="EnsemblGenomes-Gn:PANA_0519"
FT                   /db_xref="EnsemblGenomes-Tr:ADD75686"
FT                   /db_xref="InterPro:IPR025248"
FT                   /db_xref="UniProtKB/TrEMBL:D4GIU1"
FT                   /protein_id="ADD75686.1"
FT                   /translation="MAAIMTDLDNIELHFSGHETFPLRNMWLKRVYDQADIHGLVDKSI
FT                   FADESAIVRFGVGKNMVSSMKHWAIATGMLQEYKDSKYFELSMLAKLLFSDNGLDPYSE
FT                   NIATTWLLHWQLAGLFGSGAAHRTKSTTWVLLFNLFIATDFSNKDLLNIIRGFVSKNSN
FT                   KNVSENTLKRDVEVCLKSYTVLMDKPKFDDVSEPVLAELGLIRPTLPGRFGFVRGKQET
FT                   LPDGIFDYCLITFWLSNENYQNAISLNDICHAKGSPGLIFKMDEDAVAERLFNIAERTQ
FT                   GKINWVNTSGMYQVIRKMGKKENTFFELAIDRLKSSYNA"
     ttggcggcaa ttatgacgga tttagacaat atagagctcc atttttctgg gcatgaaact        60
     ttcccattac gtaatatgtg gttaaagcgt gtctatgacc aagcagacat tcatgggctt       120
     gtagataagt ccatttttgc tgatgaatca gctatagtgc gctttggtgt aggcaaaaat       180
     atggtttcct ctatgaagca ttgggcaatt gctacaggta tgcttcaaga gtataaagat       240
     tcaaaatatt tcgagttaag tatgttagct aaactgctat tttctgataa cggccttgat       300
     ccttactcag aaaatatagc aacaacttgg cttcttcatt ggcaactggc tgggcttttt       360
     ggcagtggtg cggctcacag aaccaaaagc acgacatggg tactcttatt taatttattt       420
     attgctactg atttttcaaa caaagactta ttaaatatta taagaggttt tgtttcgaaa       480
     aatagcaata aaaatgtatc tgaaaacact ctaaaacgcg atgtggaagt atgtttaaaa       540
     agctatacgg tcttgatgga taaacctaaa tttgatgatg tttcagagcc tgtgttagcg       600
     gagctgggct taatcagacc tacgttacct ggaaggtttg gttttgtaag agggaaacag       660
     gaaacattgc ctgatggaat tttcgattat tgcctgatta ccttctggct ttctaacgag       720
     aattatcaaa atgctatatc gcttaatgat atatgccacg caaaaggttc tccaggcttg       780
     atttttaaaa tggatgagga tgcggtggct gaaaggcttt ttaatattgc agagagaacg       840
     caaggtaaga taaactgggt taatacctcc ggaatgtatc aggtcattag aaaaatgggg       900
     aaaaaagaaa atactttctt tgagctagca attgacagat taaagagtag ctataatgcg       960
     taa                                                                     963
//

If you have problems or comments...

PBIL Back to PBIL home page