(data stored in SCRATCH zone)

EMBL: CP001875.PE85

CP001875.PE85        Location/Qualifiers
FT   CDS_pept        90319..91065
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PANA_0085"
FT                   /product="Hypothetical Protein"
FT                   /note="No significant BLAST hits found; COG: Unknown
FT                   Function; Subcellular localization as predicted by Psort
FT                   2.0: Unknown"
FT                   /db_xref="EnsemblGenomes-Gn:PANA_0085"
FT                   /db_xref="EnsemblGenomes-Tr:ADD75252"
FT                   /db_xref="UniProtKB/TrEMBL:D4GFY8"
FT                   /protein_id="ADD75252.1"
FT                   /translation="MKRQRQVLSLAVSSCVRKELKYPFFNRVRDAIFPVGFGNKLGNFL
FT                   HRLNCIAHRHASARVVNHGQIVFLIAYRHDVFRFQAQFFCQHFYAIAFVHPAIENLQVI
FT                   RRTFQDGVSLMRLLRQFCNRRIKQAGFINHHQFRETRGGIHLFYCAITYRNTGQAGFVN
FT                   SEFADVFVWRIEVGFIKGLKMYAQFSRQLLDIQIIVKAQRHIRHDLAIFGLMNQCAIIA
FT                   DAVLSVSLQIKLLQITLNANERPAGR"
     atgaaacggc agcgtcaggt gctttcactc gccgtttcat cctgcgtcag gaaagaatta        60
     aagtacccat ttttcaatcg cgtgcgcgac gccatcttcc ctgttggttt tggtaataaa       120
     ctgggcaatt ttcttcaccg actcaattgc attgcccatc gccacgccag tgcccgcgta       180
     gtcaatcatg gccagatcgt tttcctgatc gcctatcgcc atgacgtctt ccgctttcag       240
     gcccagtttt tctgccagca tttttacgcc atagcctttg ttcacccggc gatcgagaat       300
     ctccaggtaa taaggcgcac ttttcaggat ggtgtaagtc tgatgcgcct gctcaggcag       360
     ttttgcaatc gccgcatcaa gcaggccggg tttatcaatc atcatcagtt tcgggaaacg       420
     cgtggcggga tccatctctt ctactgcgcg ataacgtacc ggaataccgg tcaggctggc       480
     ttcgtgaata gtgaattcgc tgatgtcttt gtttggcgta tagaggtggg atttatcaaa       540
     ggcctgaaaa tgtacgccca gttctcgcgc cagcttctcg acatacaaat aatcgtcaaa       600
     gcccagcgtc acatccgcca cgacctcgcc atcttcggcc tgatgaacca gtgcgccatt       660
     attgctgatg cagtactgtc cgtgagcctg cagatcaagc tccttcagat aacgctcaat       720
     gccaacgaaa ggcctgccgg tcgctaa                                           747
//

If you have problems or comments...

PBIL Back to PBIL home page