(data stored in SCRATCH zone)

EMBL: CP001875.PSTS

CP001875.PSTS        Location/Qualifiers
FT   CDS_pept        33393..34436
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pstS"
FT                   /locus_tag="PANA_0032"
FT                   /product="PstS"
FT                   /note="Phosphate-binding periplasmic protein precursor;
FT                   Similar to Pantoea sp. At-9b, phosphate ABC transporter,
FT                   periplasmic phosphate-binding protein (NCBI:
FT                   ZP_05729619.1); COG: Inorganic ion transport and
FT                   metabolism; Subcellular localization as predicted by Psort
FT                   2.0: Periplasmic"
FT                   /db_xref="EnsemblGenomes-Gn:PANA_0032"
FT                   /db_xref="EnsemblGenomes-Tr:ADD75199"
FT                   /db_xref="GOA:D4GFT5"
FT                   /db_xref="InterPro:IPR005673"
FT                   /db_xref="InterPro:IPR024370"
FT                   /db_xref="UniProtKB/TrEMBL:D4GFT5"
FT                   /protein_id="ADD75199.1"
FT                   /translation="MTLMRSTVARILAASLAVSAVSAFAATDLTGAGGTFPAPVYAKWA
FT                   AEYQQATGSKINYQGIGSSGGVKQIIAKTVDFGASDAPMKDEDLQKNGLFQFPTVIGGV
FT                   VLAVNLPGVKSGQLTLDGKTVGDIYLGNIKKWNDPAIVKLNPGVKLPDTNINVVRRADG
FT                   SGTSFVFTSYLAKVNEEWNSKIGKGNTVNWPTGLGGKGNDGVAAFVQRLPGSIGYVEYA
FT                   YAKQNNLTYTKLMDADGKAVAPSEISFSNAAKGADWSKSFAQDLTFQKGNDAWPITSTT
FT                   FILIYKDQANAAKGAEVLKFFDWAYKNGGKTANALDYATLPESVVQQIRAAWKANIKDS
FT                   SGKALYK"
     atgacactga tgcgtagcac cgtagcccga atcctcgccg cctctcttgc cgttagtgcg        60
     gtttctgcct ttgcagccac cgatctgact ggtgctggcg gtacattccc ggcgccggtt       120
     tatgccaagt gggcagcaga gtatcagcaa gccaccggta gcaaaattaa ctatcagggc       180
     attggttcat ctggcggtgt aaaacaaatt atcgccaaaa ccgttgattt cggtgcgtcc       240
     gatgcgccta tgaaagacga agatctgcag aagaatgggc tgttccagtt ccctaccgtg       300
     atcggtggtg tggtgctggc ggttaacctg ccaggcgtaa aatctggcca actgacgctg       360
     gacggaaaaa ccgtaggtga tatctatctc ggcaatatca agaagtggaa cgatccagcg       420
     atcgttaaac tgaacccagg cgtgaaactg ccagacacca acatcaacgt ggtgcgccgc       480
     gcggatggtt caggtacctc tttcgttttc accagctacc tggcgaaagt gaatgaagag       540
     tggaacagca aaattggtaa aggaaacacc gttaactggc caaccggtct gggcggtaaa       600
     ggtaacgacg gcgttgcggc gttcgttcag cgtctgccag gctccattgg ttacgttgag       660
     tacgcgtatg ccaaacagaa taacctgacc tacaccaagc tgatggatgc ggacggtaag       720
     gccgttgcgc caagcgaaat cagcttctct aatgccgcaa aaggcgcaga ctggagcaaa       780
     tcgtttgccc aggatctgac ctttcagaaa ggcaatgatg catggccgat cacctcaacc       840
     acctttatcc tgatttacaa agaccaggct aatgcggcga aaggtgccga agtactgaaa       900
     ttcttcgact gggcttataa aaacggcggc aaaacggcta acgccctgga ttatgccacc       960
     ctgcctgaga gcgtagttca gcagatccgc gccgcatgga aagccaatat caaagacagt      1020
     tcaggtaaag cgctttacaa gtaa                                             1044
//

If you have problems or comments...

PBIL Back to PBIL home page