(data stored in SCRATCH zone)

EMBL: CP001875.PTER

CP001875.PTER        Location/Qualifiers
FT   CDS_pept        complement(587688..588767)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pteR"
FT                   /locus_tag="PANA_0505"
FT                   /product="Pter"
FT                   /note="Phosphotriesterase related protein; Similar to
FT                   Klebsiella pneumoniae 342, phosphotriesterase family
FT                   protein (NCBI: YP_002238477.1); COG: General function
FT                   prediction only; Subcellular localization as predicted by
FT                   Psort 2.0: Inner Membrane"
FT                   /db_xref="EnsemblGenomes-Gn:PANA_0505"
FT                   /db_xref="EnsemblGenomes-Tr:ADD75672"
FT                   /db_xref="GOA:D4GIS7"
FT                   /db_xref="InterPro:IPR001559"
FT                   /db_xref="InterPro:IPR017947"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:D4GIS7"
FT                   /protein_id="ADD75672.1"
FT                   /translation="MKHSIFRHPDPLPLGINSGYVMTVLGPLPVSEMGVTLMHEHILLD
FT                   ASGKWVPPCCCGDRHLAEMPVSMENLGELSLNPLISRDNCQLFDVDLAIEELMKFRALG
FT                   GDTVVDPTNIGIGRDPKALQRIARLTGLNIIMSTGLYLEPSHPEWVKTISVEALADKLI
FT                   YDLGGREEKPEVLAGLIGEIGVSSRFTASEEKSLRAAGRASAATRVPIEVHLPGWERLG
FT                   HKVLDILEHEGADLRHVVLCHMNPSFADKRYQRELAQRGAFLEYDMIGMSYYYADESAQ
FT                   SPSDEENARAIRELIDDGFIEQILLSQDVFLKTMLTRYGGHGYGYILKHFVPRLKRHGV
FT                   SGEQLETLLIANPQRVFGG"
     atgaaacact ctatttttcg gcatccggat cccctaccgc tcggcatcaa cagcggctat        60
     gtcatgacgg tgctggggcc gctgccggtc agtgagatgg gcgtgacgct gatgcatgaa       120
     cacattctgc tggatgcgtc cggcaagtgg gtgccgccct gctgctgtgg cgatcgccat       180
     ttagcggaaa tgccggtgag tatggaaaac ctgggcgaac tatcgcttaa cccgttaatc       240
     agccgcgata attgccagct gttcgatgtg gatctggcga ttgaggagct gatgaagttc       300
     cgtgctctcg gcggtgacac ggttgtcgat cctaccaata tcggcatcgg tcgggatccc       360
     aaagcattgc agcgcatcgc ccgcctgacc gggctgaaca tcatcatgag caccggcctg       420
     tacctggagc cttcgcatcc ggaatgggtg aaaacgatta gcgtcgaggc gttagctgac       480
     aagctgattt acgacctggg cggacgggaa gaaaaacccg aagtactcgc cgggttgatc       540
     ggtgagatcg gcgtgtccag ccgctttacc gccagcgagg aaaaatccct gcgggcggcg       600
     ggccgggcca gtgcagcaac ccgggtgccg attgaggtgc atctgcccgg ctgggagcgg       660
     ctggggcaca aggtgctgga tattcttgaa cacgaagggg ccgatctgcg ccacgtggtg       720
     ctgtgccaca tgaatcccag ctttgccgac aagcgctatc agcgtgaact ggcccagcgc       780
     ggtgcgtttc tggaatacga catgatcggc atgagctatt actacgccga cgagtccgcg       840
     cagtcaccgt ccgacgaaga gaacgcccgc gccatccgcg aactgatcga tgacggcttt       900
     attgagcaga ttttgctgtc ccaggacgtg ttcctgaaaa ccatgctgac ccgctacggc       960
     ggccacggct atggctacat ccttaaacat tttgttccgc gcctgaaacg ccacggcgtc      1020
     agcggcgaac aacttgaaac cttactgatt gctaacccac agcgcgtttt tggtgggtaa      1080
//

If you have problems or comments...

PBIL Back to PBIL home page