(data stored in SCRATCH zone)

EMBL: CP001875.QSEB

CP001875.QSEB        Location/Qualifiers
FT   CDS_pept        8137..8808
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="qseB"
FT                   /locus_tag="PANA_0010"
FT                   /product="QseB"
FT                   /note="Transcriptional regulatory protein QseB; Similar to
FT                   Pantoea sp. At-9b, two component transcriptional regulator,
FT                   winged helix family (NCBI: ZP_05729598.1); COG: Signal
FT                   transduction mechanisms; Subcellular localization as
FT                   predicted by Psort 2.0: Cytoplasmic"
FT                   /db_xref="EnsemblGenomes-Gn:PANA_0010"
FT                   /db_xref="EnsemblGenomes-Tr:ADD75177"
FT                   /db_xref="GOA:D4GFR3"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:D4GFR3"
FT                   /protein_id="ADD75177.1"
FT                   /translation="MRILLIEDDRLIGDGIKAGLSKLGFSVDWFVSGEAGFQALTAAPW
FT                   DAVVLDLSLPERDGLDILRQWRQQGHDVPVLILTARDALDQRVEGLQMGADDYLCKPFA
FT                   LTEVAARLQALIRRRHGQLQPELRHGDVVLIPGNLCVERNGENIALKSRELALLELFMR
FT                   NPDRVLTRSQLEEKLYTWDTEVSSNAVEVHIHHLRKKLGNRFIRTIHGVGYTLGESECD
FT                   R"
     atgcgaattt tactgattga agacgaccgc ctgattggag acggcattaa agcgggactc        60
     agtaagctgg gattcagcgt tgactggttt gtctctggcg aggccggttt tcaggcatta       120
     acggcggcgc cgtgggatgc ggtcgtactc gatttatcac tgcctgagcg tgacgggctg       180
     gacatattgc gtcaatggcg tcagcagggg cacgatgtcc cggttcttat ccttaccgcc       240
     cgcgatgcgc ttgatcaacg cgttgaagga ttacagatgg gggctgacga ttacctgtgc       300
     aaaccctttg cccttacaga agttgccgca cgcttacagg cactgattcg ccgccgccac       360
     gggcaactcc agcccgaact gcgtcatggc gatgtagtgt tgattcccgg taatctctgc       420
     gtggaaagaa acggcgaaaa tatcgcgtta aaaagccgtg agctggccct gcttgagctg       480
     tttatgcgaa atccggatcg ggtactgacg cgaagccagc ttgaagaaaa gctctatacc       540
     tgggataccg aagtgtcgag caatgcggta gaagtgcata tccatcatct gcgtaaaaaa       600
     ctcggtaacc gctttatccg caccatccac ggcgtgggct atacgctggg ggaaagcgaa       660
     tgcgatcgat ga                                                           672
//

If you have problems or comments...

PBIL Back to PBIL home page