(data stored in SCRATCH zone)

EMBL: CP001875.RHTC

CP001875.RHTC        Location/Qualifiers
FT   CDS_pept        204713..205336
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rhtC"
FT                   /locus_tag="PANA_0178"
FT                   /product="RhtC"
FT                   /note="Threonine efflux protein; Similar to Pantoea sp.
FT                   At-9b, homoserine/threonine efflux pump (NCBI:
FT                   ZP_05730689.1); COG: Amino acid transport and metabolism;
FT                   Subcellular localization as predicted by Psort 2.0: Inner
FT                   Membrane"
FT                   /db_xref="EnsemblGenomes-Gn:PANA_0178"
FT                   /db_xref="EnsemblGenomes-Tr:ADD75345"
FT                   /db_xref="GOA:D4GGP4"
FT                   /db_xref="InterPro:IPR001123"
FT                   /db_xref="InterPro:IPR004778"
FT                   /db_xref="UniProtKB/TrEMBL:D4GGP4"
FT                   /protein_id="ADD75345.1"
FT                   /translation="MLILFGTIALVHLVALMSPGPDFFFVSQTAASRSRKEAMLGVLGI
FT                   TLAVMIWAAVALMGLHLILQKMAWLHQIIMVGGGLYLLWMGWQLIGSARQRHKQPVQQE
FT                   PVVELPRKGMSFIKGLLTNLSNPKAVIYFGSVFSLFIGNDVGGLERWGLFVLISVETFA
FT                   WFSLVAAVFALPWMRDKYQRAAKWVDGVAGVLFAGFGIHLILSR"
     atgttgattt tgttcggcac gattgccctg gtccatcttg ttgcccttat gagtcccggc        60
     ccggatttct tttttgtctc gcaaaccgcc gccagccgtt cgcgcaaaga agcgatgttg       120
     ggcgttctgg gcattaccct ggcggtcatg atctgggccg cggtagcgtt gatgggcctg       180
     catctgattt tgcaaaagat ggcctggcta caccaaatca tcatggtcgg tggcggactc       240
     tatctactat ggatgggttg gcagttaatt ggctcagccc gtcagcgcca caaacagccc       300
     gtgcagcagg aacctgtcgt cgaactgccc aggaaaggca tgagctttat taaaggcctg       360
     ctgaccaacc tgtcgaatcc caaagcggtt atctactttg gtagcgtctt ttccttgttt       420
     atcggtaacg atgtgggggg gctggaacgc tgggggctgt tcgtcctgat aagcgttgaa       480
     accttcgcct ggttttctct ggtcgcggct gtttttgccc tgccgtggat gcgggataag       540
     tatcaacgtg ctgcgaagtg ggtagacggt gttgcgggcg tgctgtttgc cggttttggc       600
     attcatctga tcctgtcgcg ctga                                              624
//

If you have problems or comments...

PBIL Back to PBIL home page