(data stored in SCRATCH zone)

EMBL: CP001875.SGCQ

CP001875.SGCQ        Location/Qualifiers
FT   CDS_pept        594119..594964
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sgcQ"
FT                   /locus_tag="PANA_0511"
FT                   /product="SgcQ"
FT                   /note="Photosystem I Assembly BtpA; Similar to Klebsiella
FT                   pneumoniae 342, BtpA family protein (NCBI: YP_002238483.1);
FT                   COG: General function prediction only; Subcellular
FT                   localization as predicted by Psort 2.0: Unknown"
FT                   /db_xref="EnsemblGenomes-Gn:PANA_0511"
FT                   /db_xref="EnsemblGenomes-Tr:ADD75678"
FT                   /db_xref="GOA:D4GIT3"
FT                   /db_xref="InterPro:IPR005137"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="UniProtKB/TrEMBL:D4GIT3"
FT                   /protein_id="ADD75678.1"
FT                   /translation="MVAISAEKNDAIQAIFSRPKAVIGVIHCDPFPGSPKYRGKSVKAI
FT                   TERALRDAENYICGGVHGLIIENHGDIPFSKPEDIGPETSALMAVITEKVRERFGVPLG
FT                   INVLANAALPAFATALAGGADFIRVNQWANAYIANEGFIEGAAAKALRYRSQLRAEHIR
FT                   VFADSHVKHGSHAIVADRSIQELTRDVDFFDADAVIATGQRTGDSATLDEIDEIRAATA
FT                   LPLLVGSGVTPANVCQILGRTQGVIVASALKVDGVWWNDVDLERVKHFMAVAQAALDKA
FT                   "
     atggttgcta tatcagcaga aaaaaatgat gcaatacaag cgatattttc ccgccccaaa        60
     gcggtcattg gcgtgattca ctgtgacccg tttcccggct cgcctaaata ccgggggaaa       120
     tcagttaagg cgataacaga gcgtgccctg cgcgatgcgg aaaattatat ttgcggcggc       180
     gttcatggcc tgattattga aaaccacggc gatattccgt tttcaaaacc cgaggatatt       240
     ggcccggaaa cgtcggccct gatggcggtt atcacggaaa aagtgcgcga acggtttggc       300
     gtgccgctgg gcattaacgt gctggcgaac gcggcgctgc cggcctttgc caccgcgctg       360
     gcgggcgggg cggattttat ccgcgtcaac cagtgggcga atgcttacat cgccaatgaa       420
     ggctttattg aaggggccgc cgccaaagcg ttgcgctacc gcagccagct gcgtgccgaa       480
     catattcggg tgtttgccga cagccatgtc aaacacggca gccatgcgat agtggccgac       540
     cgctccattc aggaactgac gcgcgacgtt gacttctttg acgcggacgc cgtgatcgcc       600
     accggacagc gcaccggcga cagcgccacc ctggacgaaa tcgacgagat ccgcgccgcc       660
     accgccttac cgctgctggt ggggtcgggc gtcacgcctg ccaatgtctg ccagatcctg       720
     ggccgcaccc agggcgtgat tgtcgccagc gcgctcaagg tggacggcgt ctggtggaac       780
     gatgtggatc tggaaagggt taaacacttt atggccgtgg cgcaggcggc gctggataag       840
     gcctag                                                                  846
//

If you have problems or comments...

PBIL Back to PBIL home page