(data stored in SCRATCH zone)

EMBL: CP001875.SUMF2

CP001875.SUMF2       Location/Qualifiers
FT   CDS_pept        15335..17473
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sumf2"
FT                   /locus_tag="PANA_0015"
FT                   /product="Sumf2"
FT                   /note="Sulfatase-modifying factor 2 precursor; Similar to
FT                   Pantoea sp. At-9b, protein of unknown function DUF323
FT                   (NCBI: ZP_05729603.1); COG: Inorganic ion transport and
FT                   metabolism; Subcellular localization as predicted by Psort
FT                   2.0: Unknown"
FT                   /db_xref="EnsemblGenomes-Gn:PANA_0015"
FT                   /db_xref="EnsemblGenomes-Tr:ADD75182"
FT                   /db_xref="GOA:D4GFR8"
FT                   /db_xref="InterPro:IPR005532"
FT                   /db_xref="InterPro:IPR013216"
FT                   /db_xref="InterPro:IPR016187"
FT                   /db_xref="InterPro:IPR024775"
FT                   /db_xref="InterPro:IPR027577"
FT                   /db_xref="InterPro:IPR027625"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR042095"
FT                   /db_xref="UniProtKB/TrEMBL:D4GFR8"
FT                   /protein_id="ADD75182.1"
FT                   /translation="MNTVQPHRDLPAPTRTLMLSGQNVEQKRAELLAYFSQTWALYEDL
FT                   FTCLNDQRAWFTKAIPLRHPLIFYFGHTATFYINKLMAGRYIDDRIDDRIEAMLAIGVD
FT                   EMSWDDLNDNHYDWPSVEAVRDYRGSVKALVTQFIQEMPLELPITWDSPAWVILMGIEH
FT                   ERIHLETSSVLIRQLPVEWVKPQPQWPACAEARRDRQLVPTNALVSLPGGHITLGKTDD
FT                   TYGWDNEYGTQQVELKPFKASKMLVSNAEFYEFVQAGGYQESRWWDEEGLGWRQFAQAE
FT                   MPTFWVGNAAMPDQLKLRLMCEEVPMPWDWPAEVNQLEAAAFCRWKAEETGKSVQLPCE
FT                   AEWYQLREQVEGDQPDWQQAPGNINLAYWASSCPVDRFPQGEFYDIVGNVWQWTTTPTN
FT                   GFEGFKVHPLYDDFSTPTFDGKHSLIKGGSWISTGNEAIKSSRYAFRRHFFQHAGFRYV
FT                   ISSHQETMALNPYETDSMVSQYLDFQYGPRYFGVDNYAEALVKLALSHSQNRGEALDIG
FT                   CATGRASFELARHFEHVTGMDYSARFIDVALQLTTGEDFRYVVPEEGDLVEYRQVRLKD
FT                   FAITSEQAKRIQFVQGDACNMKPQPARYDLVLASNLIDRLRQPARFLQDVTPMLRSGGI
FT                   LVLSSPYTWLEAFTPKENWLGGVRENGEALTTLQALQRLLAADFEQIGSPQDMPFVIRE
FT                   TARKFQHTLAQVTLWRKR"
     gtgaacaccg ttcaacccca tcgcgattta cctgcgccaa cccggacgct gatgctctct        60
     ggccaaaatg tcgaacaaaa acgtgccgag ctgctggctt actttagtca gacatgggcg       120
     ctgtacgaag atctctttac ctgcctcaac gatcagcgcg catggtttac gaaagcgatt       180
     cccctgcgcc atccgctgat cttttacttt ggccacaccg ccacgttcta cattaacaag       240
     ttaatggctg gacgttacat cgatgaccgc attgacgatc gcatcgaagc catgctggct       300
     attggcgtgg acgaaatgag ctgggatgat ctcaacgaca accactacga ctggccttct       360
     gtagaagccg ttcgcgacta tcgcggtagc gtaaaagcct tagtgacaca atttattcag       420
     gagatgccgc ttgaactgcc catcacatgg gacagcccgg cctgggtgat cctgatgggg       480
     attgagcatg agcgaattca cctggaaacc tccagcgtgc tgatccgtca gctgccggtc       540
     gaatgggtga aacctcaacc gcagtggcca gcctgcgcgg aagcgcgccg cgatcgtcag       600
     ttggtgccca ccaacgcact ggtctccctg cccggtggcc acatcacgct tggtaaaacc       660
     gatgatacct atggctggga caacgagtac ggtactcagc aggttgagct aaagcctttc       720
     aaggccagca aaatgctggt cagtaacgca gagttttatg aatttgtgca ggctggtggc       780
     tatcaggaat cccgctggtg ggatgaagaa ggcctgggct ggcgccagtt tgcacaggca       840
     gaaatgccca ccttctgggt gggtaacgct gcgatgcccg atcagctgaa actccgactg       900
     atgtgtgaag aggtacccat gccgtgggac tggccagctg aggtcaatca gttggaggcc       960
     gcggcctttt gtcgctggaa agcggaagaa accggtaagt cagtccagct accctgtgag      1020
     gcggaatggt atcaactgcg cgaacaggtc gaaggcgatc agccagactg gcagcaggcg      1080
     ccaggcaata ttaatctggc ttactgggcc tcttcctgcc cggtcgatcg gttcccgcag      1140
     ggcgagttct acgacatcgt gggtaacgtc tggcaatgga caaccacccc aaccaatggc      1200
     tttgaaggct ttaaagtcca tccgctctat gacgatttct caacgcccac ctttgacggt      1260
     aagcactcac ttataaaagg tggaagctgg atttccaccg gcaatgaggc gatcaaatca      1320
     tcgcgttatg ccttccgccg tcactttttc cagcatgcgg gttttcgcta tgtgatttct      1380
     tcccaccagg aaaccatggc cttaaacccc tatgaaaccg acagcatggt ttctcagtac      1440
     ctcgatttcc agtatgggcc tcgctatttc ggcgtcgata actatgcaga agccctggtc      1500
     aaactggcac tgtcgcacag ccagaatcgg ggagaggcgc tggatattgg ctgcgccacg      1560
     ggccgggcaa gcttcgaact ggcccgccac tttgagcatg tcaccggcat ggattattcg      1620
     gcccgcttta ttgatgtggc gctccagctc accaccggcg aagatttccg ctacgtggta      1680
     cctgaagaag gcgatctggt ggaataccgt caggtacgac ttaaggactt tgctatcacc      1740
     agtgagcagg cgaagcgcat tcagtttgtt cagggcgatg cctgtaacat gaaacctcag      1800
     ccagcacgtt acgatctggt cctggcctcg aacctgatcg atcgcctgcg tcagccggca      1860
     cgttttcttc aggacgtcac gcccatgttg cgttctggtg ggatcttagt gctgtcgtca      1920
     ccttacacgt ggcttgaagc ctttaccccg aaggaaaact ggctgggcgg cgtacgtgaa      1980
     aatggagaag ccctgaccac cctgcaggca ctgcaacggt tgctggccgc cgactttgag      2040
     caaataggtt caccacagga tatgccattc gtcatccgtg aaacggcgcg taaattccag      2100
     catacgctcg cgcaggtcac tctgtggcgt aaacgttaa                             2139
//

If you have problems or comments...

PBIL Back to PBIL home page