(data stored in SCRATCH zone)

EMBL: CP001875.TRXA

CP001875.TRXA        Location/Qualifiers
FT   CDS_pept        167578..167910
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="trxA"
FT                   /locus_tag="PANA_0145"
FT                   /product="TrxA"
FT                   /note="Thioredoxin 1; Similar to Pantoea sp. At-9b,
FT                   thioredoxin (NCBI: ZP_05730660.1); COG: Posttranslational
FT                   modification, protein turnover, chaperones; Subcellular
FT                   localization as predicted by Psort 2.0: Cytoplasmic"
FT                   /db_xref="EnsemblGenomes-Gn:PANA_0145"
FT                   /db_xref="EnsemblGenomes-Tr:ADD75312"
FT                   /db_xref="GOA:D4GGL1"
FT                   /db_xref="InterPro:IPR005746"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR017937"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:D4GGL1"
FT                   /protein_id="ADD75312.1"
FT                   /translation="MSSDKIVHLTDDSFDTDVLKADGVILVDFWAEWCGPCKMIAPILD
FT                   EVAEEYDGKLTIAKLNIDDNPGTAPKYGIRGIPTLLLFKNGEVAATKVGALSKGQLKEF
FT                   LNANLA"
     atgagcagcg ataaaatcgt tcatctgacc gatgacagtt tcgacaccga cgtgctaaaa        60
     gccgacggcg ttatactggt agatttctgg gctgaatggt gtggtccttg taaaatgatc       120
     gcgccaatcc ttgatgaagt tgcagaagag tatgatggca aactgaccat cgctaagctg       180
     aatattgacg ataacccagg cactgcgcct aaatacggca ttcgcggcat cccgacgctg       240
     ctgctgttca aaaacggtga agtcgctgcg acaaaagtgg gcgcattgtc caaaggtcag       300
     ttaaaagagt tcctgaacgc caacctggcg taa                                    333
//

If you have problems or comments...

PBIL Back to PBIL home page