(data stored in SCRATCH zone)

EMBL: CP001875.UBIB

CP001875.UBIB        Location/Qualifiers
FT   CDS_pept        219696..221333
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ubiB"
FT                   /locus_tag="PANA_0192"
FT                   /product="UbiB"
FT                   /note="Probable ubiquinone biosynthesis protein UbiB;
FT                   Similar to Pantoea sp. At-9b, 2-polyprenylphenol
FT                   6-hydroxylase (NCBI: ZP_05730704.1); COG: Coenzyme
FT                   transport and metabolism; Subcellular localization as
FT                   predicted by Psort 2.0: Inner Membrane"
FT                   /db_xref="EnsemblGenomes-Gn:PANA_0192"
FT                   /db_xref="EnsemblGenomes-Tr:ADD75359"
FT                   /db_xref="GOA:D4GGQ8"
FT                   /db_xref="InterPro:IPR004147"
FT                   /db_xref="InterPro:IPR010232"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:D4GGQ8"
FT                   /protein_id="ADD75359.1"
FT                   /translation="MSFGEIRRLYFIIKVFLTYGLDELIPQMRLTLPLRLWRRCIFWIP
FT                   NQHKQELLGVRLRMAMEQLGPVWIKFGQMLSTRRDLFPPVIADELAVLQDRVAPFDGVK
FT                   AKAQIEASMGAPIESWFDDFNIIPLASASIAQVHTATLKSNGKNVVIKVIRPDILPVIK
FT                   ADMKLIYRIARWVPRLLPDGRRLRPVEVVRDYEKTLLDELNLLREAANAIQLRRNFENS
FT                   RMLYVPEVYSDYCSESMMVMERIYGIPISDVVTLEQHGVNMKLLAERGVQVFFTQVFRD
FT                   SFFHADMHPGNIFVSYDHPEDPQYIGIDCGIVGSLNKEDKRYLAENFIAFFNRDYRKVA
FT                   ELHVDSGWVPADTNVEDFEFAIRTVCEPIFEKPLAEISFGHVLLNLFNTARRFNMEVQP
FT                   QLVLLQKTLLYVEGIGRQLYPQLDLWKTAKPFLEDWIKDQIGIPAIIRAVKEKAPYWAE
FT                   KLPELPELFYDSMRQHKQLRLSVDKLANDLSVQRSRQQQARYLFGVGATLLISGTAVLL
FT                   SRPEWDLFPAALMAAGFVSWLIGWRKTN"
     atgagttttg gagagatccg ccggttatat tttattatta aggtgttttt gacttacggc        60
     cttgatgaac tgattccgca gatgcgcctg actcttccgc tcaggctatg gcggcgctgc       120
     attttctgga tccccaacca gcacaagcaa gaactccttg gcgtgcgttt gcgtatggcg       180
     atggagcagt tgggcccggt ctggatcaag tttggtcaga tgctgtcgac gcgccgtgac       240
     ctgtttcccc cggtgattgc cgatgagctg gctgtcctgc aggaccgcgt tgcccccttt       300
     gatggcgtta aagcgaaagc gcagatcgaa gcctcaatgg gcgcaccgat tgaatcctgg       360
     tttgatgact tcaatatcat tccactggcc tcagcctcta tcgctcaggt acataccgca       420
     accctgaaat ccaatggcaa gaacgtcgtt attaaggtaa tccgcccgga tatcctgccg       480
     gtcatcaaag cggacatgaa actcatctac cgcattgccc gctgggtgcc acgattgctg       540
     ccggatggcc gccgtctgcg cccggttgaa gtggtacggg attatgagaa gaccctgctt       600
     gatgaattaa acctgttgcg tgaagccgcc aatgccattc agcttcgccg caactttgaa       660
     aacagccgca tgctgtatgt gccagaggtc tattcggact attgcagtga atccatgatg       720
     gtaatggagc gcatttacgg cattcccata tctgatgtgg tgacgctgga gcagcacggc       780
     gtcaacatga agctgttagc agaacgcggt gtgcaggtat tctttaccca ggttttccgc       840
     gacagcttct ttcatgccga catgcatccg ggcaatatct ttgtcagtta cgatcatcct       900
     gaagatcctc agtatatcgg cattgactgc ggcattgtcg gttcgctgaa taaagaagat       960
     aagcgctatc tggccgagaa ctttattgcc ttcttcaatc gcgattaccg caaagtggcg      1020
     gaactgcatg tcgattcggg ctgggtgcct gccgatacca acgttgaaga cttcgagttc      1080
     gctatccgta ccgtatgcga gcccattttt gagaaaccgc tggcagaaat ctcgtttggg      1140
     catgtgctgc tgaacctgtt taacacggcg cgtcgcttca atatggaagt ccagccgcag      1200
     ctggtgctgt tgcaaaaaac cttgctttac gttgaaggca tcggtcgtca gctctatcca      1260
     caactggatc tttggaaaac ggcaaaaccc ttccttgagg actggattaa ggatcaaatc      1320
     gggattccgg cgattatccg tgcggtaaag gaaaaagccc cttactgggc agaaaaactg      1380
     ccagaactgc cagaattgtt ttacgacagt atgcggcagc ataagcaatt acgcctcagc      1440
     gtggataaac tcgcgaacga tttaagtgtc caacgttcac gtcagcagca ggcgcgttac      1500
     ctgtttggcg taggcgcgac gctgttgatt agcggaacgg cggtgctcct cagcaggcct      1560
     gagtgggacc tgtttccagc ggcattaatg gcggcgggct ttgtcagttg gttaatcggc      1620
     tggcgtaaga caaactga                                                    1638
//

If you have problems or comments...

PBIL Back to PBIL home page