(data stored in SCRATCH zone)

EMBL: CP001875.UVRA

CP001875.UVRA        Location/Qualifiers
FT   CDS_pept        complement(329980..332808)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="uvrA"
FT                   /locus_tag="PANA_0272"
FT                   /product="UvrA"
FT                   /note="UvrABC system protein A; Similar to Pantoea sp.
FT                   At-9b, excinuclease ABC, A subunit (NCBI: ZP_05731737.1);
FT                   COG: DNA replication, recombination and repair; Subcellular
FT                   localization as predicted by Psort 2.0: Unknown"
FT                   /db_xref="EnsemblGenomes-Gn:PANA_0272"
FT                   /db_xref="EnsemblGenomes-Tr:ADD75439"
FT                   /db_xref="GOA:D4GHC4"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR004602"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041102"
FT                   /db_xref="InterPro:IPR041552"
FT                   /db_xref="UniProtKB/TrEMBL:D4GHC4"
FT                   /protein_id="ADD75439.1"
FT                   /translation="MDKIEVRGARTHNLKNINLTIPRDKLIVVTGLSGSGKSSLAFDTL
FT                   YAEGQRRYVESLSAYARQFLSLMEKPDVDHIEGLSPAISIEQKSTSHNPRSTVGTITEI
FT                   HDYLRLLFARVGEPRCPDHDVPLAAQTVSQMVDQVLEQPEGRRLMLLAPVVKDRKGEHT
FT                   KTLENLATQGYIRARIDGEVCDLSDPPKLELQKKHTIEVVIDRFKVREDLATRLAESFE
FT                   TALELSGGTAIVADMDDADAEELLFSANFACPICGYSMSELEPRLFSFNNPAGACPTCD
FT                   GLGVQQYFDPDRVVQNAELSLAGGAIRGWDRRNFYYFQMLRSLSEHLNFDIEAPFSSLP
FT                   DNVRNVILYGSGKENIEFKYINDRGDTSIRRHPFEGVLNNMERRYKETESSAVREELAK
FT                   FISNRACASCEGTRLRREARHVYVENTTLPTISEMSIGHAMSFFENLKLSGQRAKIAEK
FT                   VLKEIGDRLSFLVNVGLNYLSMSRSAETLSGGEAQRIRLASQIGAGLVGVMYVLDEPSI
FT                   GLHQRDNERLLGTLIHLRDLGNTVIVVEHDEDAIRAADHVIDIGPGAGVHGGTIVAEGT
FT                   VDQIMAEEASLTGQFLSGKREIALPAERVKGDPSKVLKITGARGNNLKDVTLTLPVGLF
FT                   TCITGVSGSGKSTLINDTLFPIAQRALNGATIAEPAPYRDVAGLEHFDKVIDIDQSPIG
FT                   RTPRSNPATYTGIFTPVRELFAGVPESRSRGYNPGRFSFNVRGGRCEACQGDGVIKVEM
FT                   HFLPDIYVPCDQCKGKRYNRETLEIKYKGKSIHEVLEMTIEEAREFFDAVPALARKLQT
FT                   LMDVGLSYIRLGQSATTLSGGEAQRVKLARELSKRGTGQTLYILDEPTTGLHFADIQQL
FT                   LEVLHQLRDQGNTIVVIEHNLDVIKTADWIVDLGPEGGSGGGEILVSGTPETVANCEKS
FT                   HTARFLKPLLEK"
     atggataaga tcgaagttcg tggtgcccgc acccataatt tgaaaaacat caacctgacg        60
     attcctcgcg acaaactcat tgtggtgacg ggcctgtcag gttccggtaa gtcctctctg       120
     gcgtttgata cgctgtatgc ggaaggtcag cgccgctatg tggagtcgct ctctgcctat       180
     gcgcgccagt ttctttcttt aatggagaaa ccggacgtcg atcatatcga ggggctgtca       240
     ccggcgatct ccattgagca aaagtccacc tcgcacaacc cgcgatccac ggtggggacg       300
     atcacggaga ttcacgacta tttgcgtctg ctgtttgccc gcgtgggtga accgcgctgt       360
     ccggatcacg acgtgccgct ggcggcacag acggtcagcc agatggtcga tcaggtgctc       420
     gagcagcctg agggccgccg cctgatgctg ctggcgccgg tcgtgaaaga tcgtaaaggc       480
     gaacacacca aaacgctgga gaatctggcg acgcagggct atatccgcgc caggattgac       540
     ggcgaggtgt gcgatctttc cgatccgccc aagctggaac tgcagaaaaa acacaccatc       600
     gaagtcgtta tcgatcgctt caaagtgcgt gaagatctgg cgacgcgcct tgccgagtcg       660
     tttgaaaccg cgcttgaact ctctggcggt acggcaattg ttgctgatat ggacgatgct       720
     gatgcggaag aactgctgtt ttcggccaac tttgcctgtc cgatttgtgg atacagcatg       780
     agtgagctgg aaccgcgcct gttctcgttc aataaccctg ccggggcctg cccaacctgt       840
     gacggtctgg gcgtgcagca atatttcgat cccgatcgcg tggtgcaaaa tgctgagctg       900
     tcgctggccg gtggcgctat tcgcggctgg gatcgtcgta atttttacta tttccagatg       960
     ctgcgctcac tgtctgaaca ccttaatttt gatattgaag cgccattcag cagcctgcca      1020
     gataacgttc gcaacgtaat cctgtatgga tccggcaaag agaacattga gtttaaatat      1080
     attaacgatc ggggtgatac ctcgattcgc cgccatccgt tcgaaggcgt gctgaacaat      1140
     atggagcgcc gttataaaga gacggaatcc tccgcagtac gcgaagagct ggcgaagttt      1200
     attagcaacc gggcctgcgc cagctgcgaa ggcacacgtc tgcgccgcga agcgcgccac      1260
     gtgtatgttg aaaacacgac gttgcccact atttcagaga tgagtattgg gcacgccatg      1320
     tcattttttg aaaacctgaa actgagtggc cagcgggcta aaatcgccga gaaagtgctt      1380
     aaagagattg gcgatcgcct gagttttctg gtcaacgtcg gcctgaatta tctgtcgatg      1440
     tcgcgctctg ctgaaacgct ctccggcggt gaagctcagc gtattcgcct ggccagtcag      1500
     atcggtgccg gcctggtcgg cgttatgtac gtgctggatg aaccctccat tggcctgcat      1560
     cagcgtgata acgagcgcct gcttggaacg ctgattcacc tgcgcgattt gggtaacacc      1620
     gtcattgtgg tcgagcatga cgaggatgcg attcgtgccg ccgaccacgt tattgatatc      1680
     ggccctggcg ccggagtgca cggtggtacg attgtcgcgg aaggaaccgt cgatcagatt      1740
     atggctgaag aggcctccct gaccggtcag ttcctcagtg ggaaacgcga aatcgccttg      1800
     cccgctgagc gggtgaaagg cgatccgtct aaggtgttga aaattaccgg cgcgcggggt      1860
     aataacctta aggatgtcac cttaaccctg cctgtcggcc tgtttacctg tattaccggc      1920
     gtatccggtt caggtaaatc gacgctcatc aatgatacgc tgttcccgat tgcgcagcgc      1980
     gccctgaacg gcgcaacgat tgccgaaccg gcaccgtacc gcgacgtagc tggactggag      2040
     cacttcgata aagttattga tatcgaccaa agccctatcg gccgtacgcc gcgctccaac      2100
     ccggccactt ataccggtat tttcacgccg gtacgtgagc tgtttgccgg tgtccctgag      2160
     tcccgctctc gcggttacaa tcccggccgt ttcagcttta acgtccgtgg cggacgctgt      2220
     gaagcctgcc agggtgacgg cgtcattaaa gttgagatgc actttctgcc ggatatctat      2280
     gtgccgtgcg atcagtgcaa aggcaaacgc tataaccgtg aaacgctgga gattaaatac      2340
     aaaggcaaaa gcattcacga agtgctggaa atgaccattg aagaagcccg cgagttcttt      2400
     gatgccgttc cggcgctggc gcgtaagctg caaacgctga tggatgtagg tttatcctat      2460
     atccgtctgg gccagtcggc gacgacactc tccggtggtg aagcccagcg tgtgaagctg      2520
     gcgcgtgaat tgtcgaaacg cggtaccggc cagacgctgt atatcctgga tgaaccgacc      2580
     accgggttac actttgccga tattcagcag ttgctggaag ttctgcacca gctgcgcgat      2640
     cagggcaaca cgattgtggt gattgaacac aatcttgacg tgattaaaac ggcggactgg      2700
     attgtcgatc tgggcccaga gggcggcagc ggcggcggcg aaattctggt atcaggtacg      2760
     ccagaaaccg tggcgaactg cgagaaatcg cataccgcgc gcttcctgaa gcccttgctg      2820
     gaaaaataa                                                              2829
//

If you have problems or comments...

PBIL Back to PBIL home page