(data stored in SCRATCH zone)

EMBL: CP001875.YAFC

CP001875.YAFC        Location/Qualifiers
FT   CDS_pept        584077..585039
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yafC"
FT                   /locus_tag="PANA_0501"
FT                   /product="YafC"
FT                   /note="Putative HTH-type transcriptional regulator HI1364;
FT                   Similar to Cronobacter turicensis, hypothetical protein
FT                   Ctu_35480 (NCBI: YP_003211911.1); COG: Transcription;
FT                   Subcellular localization as predicted by Psort 2.0:
FT                   Cytoplasmic"
FT                   /db_xref="EnsemblGenomes-Gn:PANA_0501"
FT                   /db_xref="EnsemblGenomes-Tr:ADD75668"
FT                   /db_xref="GOA:D4GIS3"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D4GIS3"
FT                   /protein_id="ADD75668.1"
FT                   /translation="MVDKYAVKSKINNKKEGMMDRLTSMNVFVKAAEVGSFAAAAEQLR
FT                   LSPQMVAKHIASLETRLGTVLLNRTTRRQSLTDVGRNYYERCKVVLAEAEEADAIAMEM
FT                   KSTPSGILKVSAPLTFGAFTLAPFITRYLARYTEIQVDLELSDRLVEPFEEGYEVVIRI
FT                   GELTDSSLVAYPLKPYRLIACASPTYLARMGMPATPADLMDHVCLVYGIWSPSMPCRWH
FT                   FQRAGRVEEVKPQGRFRSNDWKALLHAALEGHGVTLGPADVLNEEIEKGRLIQILPEYD
FT                   GPARPMNMLIPTGRRQTVKIRSFVDAINQTFGLHRSTTD"
     ttggttgata aatacgcagt taagagcaag ataaacaaca aaaaggaggg aatgatggac        60
     aggcttacca gcatgaatgt ttttgtcaaa gccgcagagg ttggctcctt tgctgcggca       120
     gccgagcagc ttcgactctc acctcaaatg gtggcaaaac atatcgccag cctggaaacg       180
     cgactgggca cggtgctgct gaaccgcacg acgcggcggc aaagtctgac ggatgttggc       240
     cgtaattatt acgaacgctg caaggttgtt ctggcagagg cggaagaggc cgacgcgatt       300
     gccatggaga tgaaaagcac accttcaggc atactaaagg tgagcgcgcc cctgaccttc       360
     ggtgcgttca ctctggcacc ttttattacc cgttatctgg cacgctatac ggaaattcag       420
     gttgacctgg aacttagcga ccgcttagtt gagccgtttg aagaagggta cgaagtagtg       480
     attcgtattg gtgaattaac ggacagttca ttagttgcgt atccgcttaa gccttatcgg       540
     ttgattgcct gcgcttcgcc cacctatctg gcacgaatgg gcatgcccgc aacgcccgca       600
     gacctgatgg atcacgtgtg tttggtgtat ggcatctggt caccgtccat gccttgtcgt       660
     tggcattttc aacgcgctgg cagggttgag gaagtaaaac cacagggccg cttccgttct       720
     aatgactgga aggcgctgtt gcacgcagca ctggaaggac atggtgtgac gctcgggccg       780
     gccgatgtgc tgaatgaaga gatcgaaaaa ggccggctta tacagatttt gccggaatac       840
     gatggacctg cgcggccaat gaatatgtta atccccacag gtcgacgtca gacggtgaaa       900
     attcgcagtt ttgttgatgc cattaatcag acatttggtc tgcaccgcag cacaacggac       960
     tga                                                                     963
//

If you have problems or comments...

PBIL Back to PBIL home page