(data stored in SCRATCH zone)

EMBL: CP001875.YAHK

CP001875.YAHK        Location/Qualifiers
FT   CDS_pept        complement(327636..328739)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yahK"
FT                   /locus_tag="PANA_0270"
FT                   /product="YahK"
FT                   /note="Zinc-type alcohol dehydrogenase-like protein YahK;
FT                   Similar to Pantoea sp. At-9b, Alcohol dehydrogenase
FT                   zinc-binding domain protein (NCBI: ZP_05731736.1); COG:
FT                   General function prediction only; Subcellular localization
FT                   as predicted by Psort 2.0: Cytoplasmic"
FT                   /db_xref="EnsemblGenomes-Gn:PANA_0270"
FT                   /db_xref="EnsemblGenomes-Tr:ADD75437"
FT                   /db_xref="GOA:D4GHC2"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR029752"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D4GHC2"
FT                   /protein_id="ADD75437.1"
FT                   /translation="MIKKSRHTLTGDTMNITHAYAAQDAKSKLAPFDFKPRELRAHDVQ
FT                   LEVLFCGVCHSDLHQARNEWKNTIFPVVPGHEIVGRVTAVGPETQKYKVGDLVGVGCLV
FT                   DSCRSCPSCQEGLEQYCENGFVGTYNGEDRLTGAITYGGYSTSMVVDEDFVLRIPANLE
FT                   LAGVAPLLCAGITTYSPLRHWNVGPGKKVGIVGLGGLGHMGVKIAHAMGAHVVLFTTSP
FT                   SKIEDGKRLGADEVVISKDADQMAQHANSFDFILNTVAAQHDLNPFITLLKRDGNMTLV
FT                   GAPEHDHPAPQVFNLIFKRRSIAGSLIGGIAETQEMLDFCGEHGITSDIELIAMNQIND
FT                   AYERMLKSDVKYRFVIDINTLRDESAA"
     ttgatcaaaa aatcacgaca caccttaact ggagacacca tgaacattac ccatgcgtat        60
     gctgctcagg atgcaaaatc caaactggca ccgtttgatt tcaaaccgcg tgagcttcgt       120
     gctcatgacg tacagcttga agtgctgttc tgtggcgttt gtcactctga cttgcatcag       180
     gcacgcaatg agtggaaaaa cacaattttc ccagtggtac cgggacacga gattgtcggt       240
     cgcgttaccg ctgttggccc tgagacccaa aaatacaaag tgggcgattt ggtcggcgtc       300
     ggctgtctgg tggattcctg ccgtagctgt ccgagctgtc aggaagggct ggagcagtat       360
     tgtgaaaatg gctttgtcgg cacctacaac ggtgaagatc gcttaacagg ggccattacc       420
     tatggcggct actccacctc aatggtggtg gatgaagact ttgtactgcg tattcctgca       480
     aatcttgaac tggcaggcgt ggcaccgctg ctgtgtgccg gcattacgac ctattcgccg       540
     ctgcgccact ggaacgtagg ccccggtaaa aaagttggca tcgtcggtct gggcggcctg       600
     ggtcatatgg gcgtgaaaat tgcgcatgct atgggcgcgc atgtcgtgct gttcaccacc       660
     tctccgtcta aaatcgaaga cggtaaacgc ctgggcgcgg acgaagtggt gatctcaaaa       720
     gatgccgacc agatggctca gcatgctaac agctttgatt ttatcctgaa taccgtcgcc       780
     gcccagcacg acctcaaccc gtttatcacc ctgctgaagc gcgacgggaa tatgaccctg       840
     gttggcgcac ctgagcacga ccacccggca ccacaggttt tcaatctgat ctttaaacgc       900
     cgcagtattg ccggttcact gattggcggc attgcagaaa cccaggaaat gctggatttc       960
     tgtggcgagc atggcattac ctcagatatc gagctgattg cgatgaatca gattaacgac      1020
     gcctacgaac gtatgctgaa aagcgacgta aaataccgct ttgttattga tatcaatacg      1080
     ctgcgtgatg aatcagcggc ataa                                             1104
//

If you have problems or comments...

PBIL Back to PBIL home page