(data stored in SCRATCH zone)

EMBL: CP001875.YBIJ

CP001875.YBIJ        Location/Qualifiers
FT   CDS_pept        362005..362232
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybiJ"
FT                   /locus_tag="PANA_0298"
FT                   /product="YbiJ"
FT                   /note="Hypothetical Protein YbiJ; Similar to Pantoea sp.
FT                   At-9b, conserved hypothetical protein (NCBI:
FT                   ZP_05732061.1); COG: Unknown Function; Subcellular
FT                   localization as predicted by Psort 2.0: Unknown"
FT                   /db_xref="EnsemblGenomes-Gn:PANA_0298"
FT                   /db_xref="EnsemblGenomes-Tr:ADD75465"
FT                   /db_xref="InterPro:IPR010854"
FT                   /db_xref="InterPro:IPR025543"
FT                   /db_xref="InterPro:IPR036275"
FT                   /db_xref="UniProtKB/TrEMBL:D4GHF0"
FT                   /protein_id="ADD75465.1"
FT                   /translation="MTEEFIMKTIKTFAAVIALAVLPVAGFAQTVTATGSTLDSTEAKI
FT                   AAQAQEAGASYKITEANTNNGVHMTAELLK"
     atgaccgagg aatttatcat gaaaactatc aaaacttttg ctgctgttat cgcccttgcc        60
     gttcttcctg ttgcaggctt cgcgcaaact gtgacagcga ccggttctac tctggacagc       120
     accgaagcga aaattgctgc gcaggcgcaa gaagctggtg cttcctataa aatcaccgaa       180
     gctaacacca ataacggcgt gcacatgacc gctgaactgc tgaaataa                    228
//

If you have problems or comments...

PBIL Back to PBIL home page