(data stored in SCRATCH zone)

EMBL: CP001875.YBJX

CP001875.YBJX        Location/Qualifiers
FT   CDS_pept        116430..117392
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybjX"
FT                   /locus_tag="PANA_0108"
FT                   /product="YbjX"
FT                   /note="VirK Protein; Similar to Pantoea sp. At-9b, protein
FT                   of unknown function DUF535 (NCBI: ZP_05729714.1); COG:
FT                   Transcription; Subcellular localization as predicted by
FT                   Psort 2.0: Unknown"
FT                   /db_xref="EnsemblGenomes-Gn:PANA_0108"
FT                   /db_xref="EnsemblGenomes-Tr:ADD75275"
FT                   /db_xref="InterPro:IPR007488"
FT                   /db_xref="UniProtKB/TrEMBL:D4GGH4"
FT                   /protein_id="ADD75275.1"
FT                   /translation="MSIYTTHEPVADSYASLFFQLVSGKYVPNKRWLSRQFRFKFALRT
FT                   LIAPVTTLRYLQQLSELPRFSQLMRVQGVLPAKLHRPYLRAGMGVAARAQAILDHYHLM
FT                   NSLDNLQLRQVLQSGEESVLARLKGKNDEDFVIACSSGYYDREGEITLVLRYQGEGLAS
FT                   LSFTILNEENARTLLIGGLQGPRKSISNDVIRDATKAAHGLFPKRLLMEVVFILSQQCG
FT                   VRKIAAVGDETHVFRSLRYRQSKEEKFHASYSDFWLTINGKERADGVFMLPLALPRKTL
FT                   EEIASKKRAEYRRRYTLLDTLAEQVGTATGQQNSDRAAA"
     atgtctattt atactacaca cgagccggtt gctgattcgt atgcctctct gttttttcaa        60
     ttggtcagcg gaaagtacgt gccaaataaa cgttggctga gccgtcaatt ccgttttaaa       120
     tttgccttaa ggacgctgat tgcgcccgtg accacattgc gctatttaca gcagctctca       180
     gagttacccc ggttttcgca attaatgcgt gtgcagggag tcttacccgc gaagttacat       240
     cgcccttatc tgcgtgccgg aatgggtgta gctgcacgcg cccaggctat tctcgaccat       300
     tatcatttaa tgaacagcct ggataatctt caacttcgcc aggttttaca aagtggcgaa       360
     gagagcgtgc tggccaggct gaagggtaaa aatgatgaag attttgttat tgcctgtagc       420
     tcaggttatt acgatcgtga aggtgaaata accttagtct tgcgttatca gggagaaggc       480
     ttagcctcac tttcattcac gatcttgaac gaggaaaacg cgcgcacact cttaatcggt       540
     ggcttacagg gaccgcgtaa aagtatcagt aatgatgtta ttcgtgatgc aaccaaagcg       600
     gcacatggtt tatttcctaa acgcttattg atggaagtcg tctttatttt atctcagcaa       660
     tgtggtgtca ggaaaatagc ggcggtaggg gatgaaacgc atgtttttcg cagcctgcgt       720
     tatcgccaga gtaaagagga gaaattccat gccagctaca gcgatttctg gctgacgatc       780
     aacgggaagg agcgtgctga cggcgtcttt atgctgccgc tggcgctgcc gcgtaaaacg       840
     ctggaagaga ttgccagtaa gaagcgcgcg gaataccgcc gtcgttatac gctgctggat       900
     acgctggcag agcaggttgg gactgctact ggccagcaaa acagcgatcg ggccgccgcc       960
     tga                                                                     963
//

If you have problems or comments...

PBIL Back to PBIL home page